KEGG   Bacillus subtilis subsp. subtilis 168: BSU10800Help
Entry
BSU10800          CDS       T00010                                 

Gene name
yizA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DinB DinB_2 DUF664
Motif
Other DBs
NCBI-GeneID: 2914284
NCBI-ProteinID: YP_054576
Pasteur: BG14187
BSORF: BG14187
UniProt: Q7WY73
Structure
PDB: 

Position
complement(1159211..1159690)
Genome map
AA seq 159 aa AA seqDB search
MMKFFEYNWQVRDQWFTWCHQLTTEELLKNRLGGVENILYTLFHIIDVEYSWIRAIQGKE
DIAVQFADYQTLNKVKSLSNTFRTEIIDVLQTHSDQIKDELVSVPWETGVLYTRDEILHH
IIAHEIHHIGQLSVWARELKLSPVSASFIGRTLKPIHSY
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaaattttttgaatataactggcaggttagagatcaatggtttacttggtgtcat
caactaaccactgaagaattacttaaaaatcgtcttggcggagtagagaatattttatat
accctttttcatattattgatgtggaatatagttggattcgtgctatccaaggaaaagaa
gatatcgctgttcagttcgctgattatcaaacactcaataaagtgaaatctctctcaaat
acattccgaactgaaataattgatgttttacaaacacattcagatcaaataaaagatgaa
cttgtaagcgttccttgggagacaggtgttttatatacgcgagatgaaatattacaccat
atcatcgctcacgaaattcaccatattggtcaactttctgtatgggctagggaattaaag
ttaagcccggtatcagctagttttatcggcagaacattaaaacctattcattcttattga

DBGET integrated database retrieval system