KEGG   Bacillus subtilis subsp. subtilis 168: BSU10810
Entry
BSU10810          CDS       T00010                                 

Gene name
yisP
Definition
(RefSeq) squalene/phytoene synthase
  KO
K02291  15-cis-phytoene synthase [EC:2.5.1.32]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00906  Carotenoid biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    BSU10810 (yisP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:bsu01006]
    BSU10810 (yisP)
Enzymes [BR:bsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.32  15-cis-phytoene synthase
     BSU10810 (yisP)
Prenyltransferases [BR:bsu01006]
 Terpene biosynthesis
  Squalene/phytoene synthase
   BSU10810 (yisP)
SSDB
Motif
Pfam: SQS_PSY
Other DBs
NCBI-GeneID: 936353
NCBI-ProteinID: NP_388961
Pasteur: BG12241
BSORF: BG12241
UniProt: O06728 A0A6M3ZEJ7
Structure
PDB: 
3WE9

Position
1159922..1160746
AA seq 274 aa
MIHRSEKMKEIKEAYQQCGQIVGEYAPACFKALSYLPLKQRQASWAVLSFCHTAASADEK
VLPAFEAKADHVYQRTNNGKQHLWKAFDHAYRTFTLESEPFREFIAAQKEDAKPYDDLDE
LLMYAYRTGGAAGLMLLPILTRRKQDQLKQAAVSLGLAIQLVRFLSDLGTDQQKNRIPRQ
VMQQFGYTEADLQKGTVNKAFTMTWEYIAFEAEAYLEECQDALPLFPQYSQKTVKAALHL
HRAVLEKIRAKQHDVFQYHFALTETEVKQILSDI
NT seq 825 nt   +upstreamnt  +downstreamnt
gtgatacataggagtgagaaaatgaaagagataaaagaagcttaccagcaatgcggacag
attgttggcgaatacgcgccagcctgtttcaaagcattatcatatctcccgctaaagcaa
agacaagcctcttgggcagtattgtcgttttgccacacggcggccagtgcagacgaaaag
gtattgcccgcatttgaagctaaagctgatcatgtttaccaaaggacaaataacggtaaa
caacatctatggaaggcttttgatcatgcgtatcggacctttacattggaaagcgaacct
tttcgggagtttattgccgcacaaaaagaagacgccaagccgtatgatgaccttgatgaa
ctgctcatgtacgcatatcggacgggcggtgctgccggattgatgctgctgccgatactg
acacgccgaaaacaagatcagctcaaacaagcagccgtctctctcggcttggccatacag
ctggttcgcttcttaagtgatcttggcacagatcagcaaaaaaaccgcattccccgtcag
gtaatgcagcaattcggctatacagaggctgatctccaaaaaggcaccgtaaataaagcg
ttcacaatgacgtgggagtatatcgcttttgaagcagaagcctaccttgaagagtgtcag
gatgccttgccgctatttccgcagtattctcaaaaaacggtgaaagccgctcttcatttg
caccgggctgttttagaaaaaatccgggcgaagcagcacgatgtatttcaatatcacttc
gctctcacagagaccgaagtgaagcagattctgtctgatatctaa

DBGET integrated database retrieval system