KEGG   Bacillus subtilis subsp. subtilis 168: BSU10820
Entry
BSU10820          CDS       T00010                                 

Symbol
yisQ
Name
(RefSeq) transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MatE Polysacc_synt_C
Other DBs
NCBI-GeneID: 939335
NCBI-ProteinID: NP_388962
Pasteur: BG12242
BSORF: BG12242
UniProt: O07940 A0A6M3Z9T9
Position
complement(1160776..1162143)
AA seq 455 aa
MKQAVFKSTALKKPADKTFSLFSLTWPIFIEVSLYMFMGNADTLMLSQYSDNSVAAVGVS
NQILNLIIVMFSFIATGTTVIISQFLGSRQKKEAMEVAYVSIGANFFISLAISAVVFFAA
VPLLHMMGLSDALMPDAKVFLQVVGGLSFIQALIMTFSAILKSYGYTKDTMFVTIGMNIL
NIAGNFVVIFGLFGFPVLGVAGVAMSTSIARVIGLIAMIVIVNKRIQLKMSLKKVFHMHK
EHLRKLLKIGIPSAGEQLSYNLSQMIVTYFIAIMGAQALTTKVYTQNITMFILLFGTAIS
QGTQILIGRYIGGKQFDAAYERCMKSLYWALGIAAATSVLMTIFSKDLIGLFTQSPDIIA
TASLLIAMTIILEPGRSFNVIIINSLRAAGDAKFPVYMAMISMWGIGLPLAYLFGIHLGF
GLAGIWISFIADEWVRGILMYRRWRSRIWIQKGMA
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgaaacaagctgtcttcaaatcaactgctttgaaaaaacccgctgacaaaacgttctca
ttattttcgcttacttggccgatctttattgaggtctcattatatatgtttatgggtaat
gccgatacactgatgctcagccaatactcggataacagcgtggcagcagtcggcgtcagc
aaccagattttaaatttaattatcgtgatgttcagctttatcgcaacaggaacgaccgtt
atcatttcacaatttctaggctcacggcaaaagaaagaagccatggaagtcgcttatgtg
tcaatcggcgccaacttcttcatcagcctggccatcagcgccgtcgtctttttcgcggct
gtccctctgcttcatatgatgggattatcagacgcactgatgcctgatgcgaaagtcttt
ttacaagttgtcggaggtctgtcctttattcaggctttaatcatgacattcagcgcgatc
ttaaaaagctacggctacacaaaagatacaatgtttgtcactatcggcatgaacatttta
aacattgccggaaactttgttgtgattttcggtttgttcggctttcctgttctcggtgtt
gccggtgtggccatgtccacatctatcgcccgcgtcatcggattaatcgcgatgattgtg
attgtcaacaaacgcatccagctgaagatgtcgctgaaaaaagtctttcatatgcataaa
gagcatttgcgcaagctgctgaaaatcggcattccttctgcgggagagcagctttcatac
aacctgtcgcaaatgatagtcacgtattttatcgccatcatgggcgcgcaggcgttgaca
acaaaagtgtatacgcaaaatattacgatgtttattttgctgttcggcactgcgatcagc
cagggtacacaaatcttaatcggccgttatatcggcggcaaacaatttgatgccgcttat
gagcgctgcatgaagagcttatattgggcactcggaattgctgcggctacctctgttttg
atgacgatcttttcaaaagacctgatcggactcttcacacaaagccctgacattatagca
actgcaagcctattgattgccatgaccattatccttgaaccaggccgctcgtttaatgtc
attatcattaactctctgcgggccgcgggggatgcgaaattcccggtttacatggcaatg
atttcaatgtggggcattggcctcccgcttgcttatcttttcggcatccacctcggtttc
ggtcttgccggcatttggatttcttttatcgcggatgaatgggtccggggaatcttaatg
tacagaagatggcgctcacgtatctggattcaaaaaggtatggcgtaa

DBGET integrated database retrieval system