KEGG   Bacillus subtilis subsp. subtilis 168: BSU10830
Entry
BSU10830          CDS       T00010                                 

Symbol
yisR
Name
(RefSeq) AraC family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HTH_AraC HTH_18 AraC_binding Cupin_2 Ribosomal_S4 DUF2368
Other DBs
NCBI-GeneID: 936352
NCBI-ProteinID: NP_388963
Pasteur: BG11064
BSORF: BG11064
UniProt: P40331 A0A6M3ZKS3
Position
1162267..1163130
AA seq 287 aa
MPRILFTVPPFPVFIAAGEGVFKKGETHVKRVFSVFDLIYVKQGTLYITENETSFSVEGG
EYILLSPGLEHYGTKGSDEATSYYWLHFDEHRYEFTAKGGSNWSELQQEKGSFEELARYG
LALPRKGKVQRPQFMAQQFEKLIDYSAENSDLPLRKQILFEELMLHLQKEAFQIPSAKER
VAWEAARYLQEHYKEKTTIKDLSLALHYHQDYVSRCMQQVLGVTPAQYTNRVRMTEAKRL
LSSTNDKMGVIAETVGMEDPTYFSKLFKQIEGISPIEYRKIVSRKVQ
NT seq 864 nt   +upstreamnt  +downstreamnt
atgcctcgcatcctgtttacagtcccgccttttccggtatttatcgcagctggggaaggg
gtttttaaaaaaggagaaacccatgtgaaacgtgtattctccgtgtttgatctgatatat
gtcaaacagggaacgttatatataacggaaaatgaaacatcgttttctgttgaaggcggc
gagtacatcttgctttctcccggtcttgaacactacgggacgaagggcagtgatgaagca
acctcctactattggcttcacttcgatgaacatcgatatgaatttacggcaaagggaggc
agcaactggtctgagcttcagcaggaaaaagggagcttcgaagagctggcccgctacgga
ttggccttgccgagaaaaggcaaggtgcagcgcccgcagtttatggcgcagcagtttgaa
aagctgatcgattactccgcggaaaactctgatttgccgctcagaaagcaaattttattt
gaggagctgatgctgcatcttcaaaaagaagcgttccaaataccgtctgcgaaagagcgg
gtagcctgggaggcggcccggtatttacaggagcactataaggaaaagacgacaatcaag
gatctgtcgctcgcccttcactatcatcaggattatgtgagccgctgcatgcagcaggtg
ctcggcgtaactccggcacaatacacgaaccgggtgagaatgacggaagcgaagcgtctt
ttatcctctacaaatgataaaatgggcgttattgcggaaacggtcggaatggaagatccg
acatacttttcaaaactctttaagcagatagaaggcatttcaccaattgaataccggaaa
attgtcagccggaaagttcaataa

DBGET integrated database retrieval system