KEGG   Bacillus subtilis subsp. subtilis 168: BSU10850
Entry
BSU10850          CDS       T00010                                 

Symbol
yisS
Name
(RefSeq) oxidoreductase
  KO
K16043  scyllo-inositol 2-dehydrogenase (NAD+) [EC:1.1.1.370]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00562  Inositol phosphate metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BSU10850 (yisS)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.370  scyllo-inositol 2-dehydrogenase (NAD+)
     BSU10850 (yisS)
SSDB
Motif
Pfam: GFO_IDH_MocA_C GFO_IDH_MocA
Other DBs
NCBI-GeneID: 939785
NCBI-ProteinID: NP_388965
Pasteur: BG11065
BSORF: BG11065
UniProt: P40332 A0A6M3Z9H2
Position
1164370..1165398
AA seq 342 aa
MEHQVRCAVLGLGRLGYYHAKNLVTSVPGAKLVCVGDPLKGRAEQVARELGIEKWSEDPY
EVLEDPGIDAVIIVTPTSTHGDMIIKAAENGKQIFVEKPLTLSLEESKAASEKVKETGVI
CQVGFMRRFDPAYADAKRRIDAGEIGKPIYYKGFTRDQGAPPAEFIKHSGGIFIDCSIHD
YDIARYLLGAEITSVSGHGRILNNPFMEQYGDVDQALTYIEFDSGAAGDVEASRTSPYGH
DIRAEVIGTEGSIFIGTLRHQHVTILSAKGSSFDIIPDFQTRFHEAYCLELQHFAECVRN
GKTPIVTDIDATINLEVGIAATNSFRNGMPVQLDVKRAYTGM
NT seq 1029 nt   +upstreamnt  +downstreamnt
gtggaacatcaagtaagatgtgcagtattgggattaggaaggctcggttattatcatgcg
aaaaatctcgtcaccagtgtgccgggggcaaagctggtttgtgtcggtgatccgttaaaa
gggagagcggagcaggttgccagagaactcggtatcgaaaaatggtcagaggacccgtat
gaagtgttagaagatcccggcattgatgctgtcattatcgtaacgccgacaagcacacat
ggtgatatgatcatcaaagcagccgagaacggcaaacagatctttgttgaaaaaccgctg
acattaagccttgaggaatcaaaagcagcttctgaaaaagttaaggagacaggtgtcatc
tgccaagtcggctttatgagacggttcgatcccgcatacgcagatgccaaacggcggatc
gacgctggagaaatcggcaaacctatctattataaaggctttacgcgcgaccaaggcgcg
cctcccgcagaatttatcaaacacagcggtggaatttttatcgactgttccatccatgac
tatgatattgcccgttatttgctaggggcggaaatcacttctgtttcaggacacggcagg
attctgaacaatccgtttatggagcagtatggcgatgtggatcaggcgctgacgtatatt
gaatttgactcgggcgcagcgggggacgtcgaggcaagcagaacctctccatacggacat
gacatccgggcggaggtgatcgggacagagggcagtattttcatagggacattgagacat
caacatgtgaccatcctatcggctaaagggagcagttttgatatcattccagactttcaa
actcgttttcatgaagcctactgcttggagcttcagcatttcgccgagtgtgtccggaat
ggaaaaacaccgattgtgactgatattgatgcgacgatcaatttagaagtgggtatcgcc
gcaaccaattcctttcgaaacggcatgccggtacagctagatgtgaagcgcgcttataca
ggtatgtaa

DBGET integrated database retrieval system