KEGG   Bacillus subtilis subsp. subtilis 168: BSU10860
Entry
BSU10860          CDS       T00010                                 

Symbol
yisT
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DinB DinB_2 DUF3830 Ferritin
Other DBs
NCBI-GeneID: 936355
NCBI-ProteinID: NP_388966
Pasteur: BG12243
BSORF: BG12243
UniProt: O07939 A0A6M3Z998
Position
complement(1165449..1165958)
AA seq 169 aa
MTDAKQFYDYHSWANKKIFTHIENLPEETAYQEVKSVFPSVSDVLLHMCRADYIWLNVLS
GVAYQEIIDSAGKLQSAQGNMAAIKQHAAELESQYHDFFSRQTDLEQTFTMQHPKLGTLE
STYADTILHVVNHGTYHRGNVTAMLRQLDHSGVPTDYMYYLYEKRESKG
NT seq 510 nt   +upstreamnt  +downstreamnt
atgactgatgcaaaacagttttatgactatcattcttgggcaaacaagaaaatatttacc
catatcgaaaacctgccggaggaaactgcctatcaagaagtaaagagcgtatttccttct
gtcagcgacgtgctgcttcatatgtgcagggctgactacatttggctgaatgttctttcg
ggagtggcctaccaagagattatagacagcgcaggcaaattacagtccgcgcaaggtaat
atggcagcgattaaacagcacgctgccgagctggagtcacagtatcatgatttcttcagc
cgccagacggacttagaacagaccttcacaatgcagcatccgaaactaggtacactggaa
tcaacctatgcagacaccatcctgcatgtcgtcaatcacggcacttaccacagagggaac
gtaaccgccatgctgagacagctggaccattcaggcgtacctactgattatatgtactat
ttatatgagaaaagagaaagcaagggctaa

DBGET integrated database retrieval system