KEGG   Bacillus subtilis subsp. subtilis 168: BSU10870
Entry
BSU10870          CDS       T00010                                 

Symbol
yisU
Name
(RefSeq) amino acid transporter YisU
  KO
K06895  L-lysine exporter family protein LysE/ArgO
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU10870 (yisU)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU10870 (yisU)
SSDB
Motif
Pfam: LysE DUF4079
Other DBs
NCBI-GeneID: 939338
NCBI-ProteinID: NP_388967
Pasteur: BG13100
BSORF: BG13100
UniProt: O06730 A0A6M4JH95
Position
complement(1166008..1166670)
AA seq 220 aa
MTISLMIEKKCERSFFSMNAIIHGIVLAFGLILPLGVQNVFIFQQGALQKHIWRALPAVI
SASVCDTLLIVLAVAGVSVIVQELPVFETVMMAGGFLFLLYMGWVTWNIRPNTSQNEKHT
FTPKKQAAFAAAVSLLNPHAILDTIGVIGTSSLQYSGLEKWLFMAACIAVSWIWFISLAI
AGRLFQTIDTSGRLMLIVNKCSAAVMWAAAGYFGVSLFCN
NT seq 663 nt   +upstreamnt  +downstreamnt
gtgacaatctctcttatgattgaaaaaaaatgtgaaaggagctttttcagcatgaatgca
atcattcacggaattgtgctcgcgtttggcttaattttgccgctgggagtgcagaatgtg
tttatttttcagcaaggcgcgttgcaaaagcatatttggcgggctctcccagctgtcatc
agtgcttcagtctgcgataccttgttaattgtattagccgttgcgggcgtgtctgtcatt
gtgcaggagctgcctgtgtttgagacagtcatgatggccggcggatttttatttttgctt
tatatgggctgggtgacttggaacatccgtccgaacacaagccaaaatgagaaacatacg
ttcacaccaaaaaagcaagctgcgtttgcggccgctgtttctcttttaaacccgcatgcc
attctggacacgatcggcgtcatcggcacgagctctcttcaatattcggggcttgagaaa
tggctctttatggccgcctgcatcgctgtgtcttggatttggttcatcagccttgcaata
gcgggccggttgtttcagacgatagatacgagcggcaggcttatgctgatcgtaaacaaa
tgctctgcagcggtaatgtgggcagcggcaggatattttggggtgtcactcttttgcaat
tga

DBGET integrated database retrieval system