KEGG   Bacillus subtilis subsp. subtilis 168: BSU10880Help
Entry
BSU10880          CDS       T00010                                 

Gene name
yisV
Definition
(RefSeq) GntR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 GntR Aminotran_MocR HTH_Crp_2 MarR_2 MarR Fe_dep_repress HTH_11 HTH_36 HTH_24 Rrf2 HTH_27
Motif
Other DBs
NCBI-GeneID: 936360
NCBI-ProteinID: NP_388968
Pasteur: BG13101
BSORF: BG13101
UniProt: Q796Q6
Position
1166737..1168191
Genome map
AA seq 484 aa AA seqDB search
MTLSQWQPSRKSDVPLHRQIEQYMKDKILHGEWAVGTKIPSQRTLADMFQVNRSTVTAAI
DELTSQGLLEGRKGGGTKVVNSTWSVLTAEPPLDWSDYVRSGIHRANSSIIQAINQNEPR
ADIIRLGTGELSPDLVPADTIGRMFQQINPGVLSLGYEQPKGNRQLREAVADHLKGKKIH
VSPSAILIVSGALQALQLISIGLLKRDSVILTEKPSYLQSLHVFQSAGMRLRGLPMDDEG
VKAGLVSSNRKQYGGQLLYTIPSFHNPTGTVMSEQRRKEIISLSKKEQMPIIEDDAYGDL
WFEEKPPQPLKAMDHEGNILYLGAFSKTVSPGLRIGWLAGPEPVIERLADIKMQTDYGSS
GLSQWAAAEWLSQGYYEEHLTWVRRKLKERRDAAVHFLERYAGDIATWRIPAGGFYIWVT
FHKNLPVSRFFYELLKRQVLVNPGYIYDGEDRNSIRLSYSYASLGDLETGIKAAAETARR
LMMS
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaccttgtcgcaatggcagccaagccgaaagtcggatgttccgctgcatcggcagatc
gaacaatatatgaaagacaagattcttcacggagagtgggctgtagggacgaaaatcccc
tcacagagaacgctggccgacatgtttcaagtcaaccgcagcacagtcacagcagccata
gatgaactcacgtctcaaggcttgttagagggaagaaaaggcggcggtacgaaggttgta
aacagtacttggagcgtgctgacggctgagcctccgcttgattggagcgattacgtccgt
tcgggcattcatcgcgccaattcttccatcattcaagctattaatcagaacgaaccaaga
gcggatatcatcagattaggaactggagaactttcaccggatcttgtgcctgctgacaca
attggacggatgtttcagcaaatcaatccgggcgtcctgtctttaggatatgagcagccg
aaaggaaaccgtcagctgcgggaggcagtggccgaccatttaaaaggaaagaagatccat
gtgtcaccgtctgcaattttaattgtgtccggtgcacttcaggcacttcagctcatctca
attggacttttaaaacgagattctgtcattttgacggagaagccgtcctaccttcaatcc
ttgcatgtatttcaatcagctgggatgcggcttcgcggcttgccgatggatgatgaaggg
gtcaaagcggggcttgtttcttctaatcgaaaacaatatggaggacagctgctttacacg
attccgtcgtttcataatccgacaggcacagtcatgtcagagcagcgaaggaaagagatc
atcagcctgtcaaaaaaagagcagatgcccatcattgaggatgatgcgtacggtgattta
tggtttgaagaaaaaccgccgcagccgttgaaagcaatggatcatgagggcaatattctg
tatctgggcgcgttttcaaaaacggttagccccggtctgcgaatcggctggcttgccggt
ccggagccggttattgaaaggctggcggacattaaaatgcagacagactacggatcaagc
ggcctgtcccagtgggcggctgccgagtggctgtcacagggatattatgaagagcatctg
acttgggtacgcaggaagcttaaagaaaggagagacgccgccgttcattttctcgagcgg
tatgccggggacattgccacgtggcggattcccgcaggcggcttttatatttgggtgaca
tttcacaaaaacctgcctgtcagccgtttcttttatgaattgctgaaacggcaggtgctt
gtgaatcccggctatatttatgacggtgaagaccgaaacagcatcaggctgtcatattcc
tatgcatctcttggagatttggaaactggcattaaagcggcagctgaaacagcacgccgc
ctgatgatgtcctag

DBGET integrated database retrieval system