KEGG   Bacillus subtilis subsp. subtilis 168: BSU10890
Entry
BSU10890          CDS       T00010                                 

Symbol
yisX
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Pentapeptide Pentapeptide_4 Pentapeptide_3 Beta_helix CfAFP
Other DBs
NCBI-GeneID: 939343
NCBI-ProteinID: NP_388970
Pasteur: BG13103
BSORF: BG13103
UniProt: O06733 A0A6M4JGS1
Position
complement(1168199..1168837)
AA seq 212 aa
MNKIAIQKPNIPENLQTADFHDAVTQDDVISMHLFEDCTICGEDIERLCVEKTVFRNVVF
IDVSFRHIELTDVIFEKCDLSNADFSGAVIHRTSVKQSKMVGMNVAEATLRNVSFEECHG
HFSSFSYSNMKQVRFDHCALMQSECSDTVLQQTHFDGCELEGASFTGTSLQNMDISTCRF
EQLHVSLDKLKGCKIAPEHAIAFARALGAVIV
NT seq 639 nt   +upstreamnt  +downstreamnt
atgaataaaatcgcaattcaaaaaccgaacataccggaaaacctgcaaaccgcagatttt
catgatgccgtgacacaggatgatgtaatcagcatgcatttgtttgaagattgcaccatc
tgcggcgaagatatcgaaagactatgtgttgaaaaaacggtattcagaaatgtcgtcttt
atcgatgtgtcttttcggcatattgaactgaccgatgtgatctttgaaaaatgcgattta
tcaaacgccgatttcagcggggctgtcattcacagaacttcagttaagcagtcaaaaatg
gttggaatgaatgtggcggaagcaacgctgcggaatgtttcattcgaggaatgccacgga
catttcagctcattttcgtactcaaatatgaaacaagttcgatttgatcactgtgctctt
atgcaaagtgaatgcagcgatacggtgctccagcagacacactttgacggatgcgaattg
gaaggcgccagctttaccggcacgtcccttcaaaacatggacatcagcacgtgccgtttt
gaacagcttcatgtctccctcgacaaattgaaaggctgcaaaatcgcacctgagcacgcg
attgccttcgccagggcactgggagctgtcatcgtataa

DBGET integrated database retrieval system