KEGG   Bacillus subtilis subsp. subtilis 168: BSU10890Help
Entry
BSU10890          CDS       T00010                                 

Gene name
yisX
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pentapeptide_4 Pentapeptide Pentapeptide_3 CfAFP Beta_helix
Motif
Other DBs
NCBI-GeneID: 939343
NCBI-ProteinID: NP_388970
Pasteur: BG13103
BSORF: BG13103
UniProt: O06733
Position
complement(1168199..1168837)
Genome map
AA seq 212 aa AA seqDB search
MNKIAIQKPNIPENLQTADFHDAVTQDDVISMHLFEDCTICGEDIERLCVEKTVFRNVVF
IDVSFRHIELTDVIFEKCDLSNADFSGAVIHRTSVKQSKMVGMNVAEATLRNVSFEECHG
HFSSFSYSNMKQVRFDHCALMQSECSDTVLQQTHFDGCELEGASFTGTSLQNMDISTCRF
EQLHVSLDKLKGCKIAPEHAIAFARALGAVIV
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaatcgcaattcaaaaaccgaacataccggaaaacctgcaaaccgcagatttt
catgatgccgtgacacaggatgatgtaatcagcatgcatttgtttgaagattgcaccatc
tgcggcgaagatatcgaaagactatgtgttgaaaaaacggtattcagaaatgtcgtcttt
atcgatgtgtcttttcggcatattgaactgaccgatgtgatctttgaaaaatgcgattta
tcaaacgccgatttcagcggggctgtcattcacagaacttcagttaagcagtcaaaaatg
gttggaatgaatgtggcggaagcaacgctgcggaatgtttcattcgaggaatgccacgga
catttcagctcattttcgtactcaaatatgaaacaagttcgatttgatcactgtgctctt
atgcaaagtgaatgcagcgatacggtgctccagcagacacactttgacggatgcgaattg
gaaggcgccagctttaccggcacgtcccttcaaaacatggacatcagcacgtgccgtttt
gaacagcttcatgtctccctcgacaaattgaaaggctgcaaaatcgcacctgagcacgcg
attgccttcgccagggcactgggagctgtcatcgtataa

DBGET integrated database retrieval system