KEGG   Bacillus subtilis subsp. subtilis 168: BSU10910
Entry
BSU10910          CDS       T00010                                 

Symbol
yisZ
Name
(RefSeq) adenylyl-sulfate kinase
  KO
K00860  adenylylsulfate kinase [EC:2.7.1.25]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu00920  Sulfur metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Module
bsu_M00176  Assimilatory sulfate reduction, sulfate => H2S
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BSU10910 (yisZ)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU10910 (yisZ)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.25  adenylyl-sulfate kinase
     BSU10910 (yisZ)
SSDB
Motif
Pfam: APS_kinase AAA_33 Torsin AAA_18 AAA_16 KTI12 MeaB P-loop_TraG Zeta_toxin SWI2_SNF2 AAA_29 PhoH Thymidylate_kin
Other DBs
NCBI-GeneID: 936359
NCBI-ProteinID: NP_388972
Pasteur: BG13105
BSORF: BG13105
UniProt: O06735 A0A6M4JF37
Position
complement(1169877..1170476)
AA seq 199 aa
MTHNPNIIWHPAAISKSDRQSLNGHKSCVLWFTGLSGSGKSVLANAVDEKLYRKGIQSYV
LDGDNIRHGLNKDLGFQTGDRIENIRRIGEVAKLFVDSGQMILTAFISPFREDRDMVRAL
FPKGEFFEIYVKCPLHVCEQRDPKGLYKKARNGEIKHFTGIDSPYEAPLSPDFIIESDQT
SISDGADLIINALQNRGII
NT seq 600 nt   +upstreamnt  +downstreamnt
atgacacacaatccgaacatcatttggcatcccgctgccatctcaaagtctgacagacag
tccttaaacggacacaaaagctgcgtcctttggtttacaggtttgtccggctccggaaaa
tcggtgctggccaatgctgtcgatgaaaagctttaccgcaagggcattcagagctacgtg
cttgacggtgataatatccgccacggcttaaacaaagatcttggatttcagactggtgac
aggattgaaaacatccgccggatcggagaagtggcgaagctgtttgtcgacagcgggcaa
atgattttaacggcttttatttctccattcagagaggatcgggacatggttagagcgctc
tttcctaaaggtgagttcttcgaaatttatgtgaagtgcccgctgcatgtttgtgaacag
cgcgatccaaaagggctttataaaaaagcgcgaaacggagagatcaaacatttcaccggg
atcgattctccgtatgaagcgccgctttcacccgatttcatcattgagtctgaccagacc
tctatttccgatggagctgatctcatcattaacgcactgcaaaacagaggaattatataa

DBGET integrated database retrieval system