KEGG   Bacillus subtilis subsp. subtilis 168: BSU10930
Entry
BSU10930          CDS       T00010                                 

Gene name
yitB
Definition
(RefSeq) phosphoadenosine phosphosulfate reductase
  KO
K00390  phosphoadenosine phosphosulfate reductase [EC:1.8.4.8 1.8.4.10]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00920  Sulfur metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Module
bsu_M00176  Assimilatory sulfate reduction, sulfate => H2S
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BSU10930 (yitB)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.8  phosphoadenylyl-sulfate reductase (thioredoxin)
     BSU10930 (yitB)
    1.8.4.10  adenylyl-sulfate reductase (thioredoxin)
     BSU10930 (yitB)
SSDB
Motif
Pfam: PAPS_reduct
Other DBs
NCBI-GeneID: 939787
NCBI-ProteinID: NP_388974
Pasteur: BG13107
BSORF: BG13107
UniProt: O06737 A0A6M3Z9U9
Position
complement(1171755..1172465)
AA seq 236 aa
MNETITYDTWNDMLSKQITDQLIDELDVLKWAYRTYGEKIVYACSFGAEGMVLLDLISKI
NKNAHIIFLDTGLHFQETYELIETVKERYPGFAIQMLEPELSLTEQGTKYGGELWKHNPN
LCCQLRKIEPLKKHLSGMTAWISGLRRDQSPTRKHIQYVNLDQKFELIKICPLIHWTWDD
VWTYIRLHNLPYNKLHDQHYPSIGCEMCTLPSPDPNDERAGRWAGREKTECGLHQE
NT seq 711 nt   +upstreamnt  +downstreamnt
ttgaacgaaaccatcacatatgacacttggaacgacatgctgtccaaacagataacggat
caattgatcgatgagctcgatgtgttgaaatgggcttaccgaacgtacggagaaaagatt
gtgtacgcctgcagctttggcgcagaaggaatggtgcttctcgacttaatatcaaaaatc
aacaaaaacgcacacatcatctttttggataccgggcttcattttcaggaaacatatgag
ctgatcgagaccgtcaaagaacgatatccgggatttgcaatccagatgctcgaacccgag
ctgagcttaacagaacaggggacgaagtacggcggagagctgtggaagcataacccgaac
ctctgctgccaattgcggaaaatcgaaccgctcaaaaagcacctgtccggcatgacagct
tggatttcaggactgcgccgggatcagtcaccaacgagaaagcatattcaatacgtaaac
ctggaccagaagtttgagctcatcaaaatttgcccgcttatccactggacatgggatgac
gtttggacgtacatccgcctgcacaatttgccttataacaaactgcacgatcaacattat
ccgagcataggctgtgaaatgtgtacactgccttccccggacccgaacgatgagagggct
ggaagatgggccggacgggagaaaacagaatgcggcctgcatcaagaatag

DBGET integrated database retrieval system