KEGG   Bacillus subtilis subsp. subtilis 168: BSU10940
Entry
BSU10940          CDS       T00010                                 

Symbol
yitC
Name
(RefSeq) 2-phosphosulfolactate phosphatase
  KO
K05979  2-phosphosulfolactate phosphatase [EC:3.1.3.71]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00680  Methane metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    BSU10940 (yitC)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.71  2-phosphosulfolactate phosphatase
     BSU10940 (yitC)
SSDB
Motif
Pfam: 2-ph_phosp
Other DBs
NCBI-GeneID: 936357
NCBI-ProteinID: NP_388975
Pasteur: BG13108
BSORF: BG13108
UniProt: O06738 A0A6M3Z9Q3
Position
1172650..1173336
AA seq 228 aa
MPIAIYQGHHHSLAPADINIVIDVIRAFTVAHYAFIGGAKEILLVRTADEAFALKDTYPD
YVLTGEEKGVGISGFDLDNSPKRMAGQNMTDKSLIQKTTNGVTAALGALNAKHLFVTGFS
NAKTTAQHVKKLVANDCVINIVASHPSGDDDMACAEYIKGIIEGTNVVTAAEAIERIKGS
SVAEKFFDCRQPLFDSEDIVYCTKELTGDFVMKVKQDGEVPTIERVII
NT seq 687 nt   +upstreamnt  +downstreamnt
atgccgattgccatttatcaggggcatcatcattcgcttgccccggcggacattaacatc
gtcattgatgtcatcagagcctttacggtcgcccattatgcgtttatcggcggggcgaaa
gagattttgttggtccggacagctgatgaagcctttgcgctgaaagacacctatccggat
tatgttttgacgggagaggaaaagggggtcggtatcagcggatttgatttagataattct
ccaaaacgtatggctgggcagaatatgacggataaaagcctgatccagaaaacaacaaac
ggcgtcacagcagcattgggggcgctgaacgcaaagcatctgttcgtaactggattttcc
aatgccaaaacaacggcacagcatgtgaaaaagctcgtcgcaaacgattgtgtcataaac
atagtggcttcccatccatccggtgatgacgatatggcatgtgcggagtatatcaaaggc
atcattgaagggacaaatgtggtaacggctgcggaggcgattgaaagaataaaaggctct
tctgttgcggagaagttttttgactgccgccagccattgtttgattcggaagacatcgtt
tactgtacaaaagaactgacgggcgatttcgtgatgaaagtgaaacaagatggagaagtt
ccaacgatagagagggtcataatatga

DBGET integrated database retrieval system