KEGG   Bacillus subtilis subsp. subtilis 168: BSU10950Help
Entry
BSU10950          CDS       T00010                                 

Gene name
yitD
Definition
(RefSeq) phosphosulfolactate synthase
  KO
K08097  phosphosulfolactate synthase [EC:4.4.1.19]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00680  Methane metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    BSU10950 (yitD)
Enzymes [BR:bsu01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.19  phosphosulfolactate synthase
     BSU10950 (yitD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComA
Motif
Other DBs
NCBI-GeneID: 939794
NCBI-ProteinID: NP_388976
Pasteur: BG13109
BSORF: BG13109
UniProt: O06739
Structure
PDB: 

Position
1173333..1174091
Genome map
AA seq 252 aa AA seqDB search
MNDFSLELPVRTNKPRETGQSILIDNGYPLQFFKDAIAGASDYIDFVKFGWGTSLLTKDL
EEKISTLKEHDITFFFGGTLFEKYVSQKKVNEFHRYCTYFGCEYIEISNGTLPMTNKEKA
AYIADFSDEFLVLSEVGSKDAELASRQSSEEWLEYIVEDMEAGAEKVITEARESGTGGIC
SSSGDVRFQIVDDIISSDIDINRLIFEAPNKTLQQGFIQKIGPNVNLANIPFHDAIALET
LRLGLRSDTFFL
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatttttcactagaattgccagtgagaacaaacaagccgagagaaaccgggcag
tccattttaattgataacggctatcccttgcaatttttcaaagatgcgatagccggagcg
tccgactatattgattttgtgaaattcggctggggcacatcattacttacgaaagatctt
gaagaaaaaatcagcacactgaaagaacatgacattacatttttctttggcggcacactg
tttgaaaagtacgtaagccagaaaaaagtgaatgaatttcatcggtactgcacctatttc
ggctgtgaatatattgagatttcaaacggtacgctcccgatgacaaataaagagaaagcg
gcttacattgccgatttttctgatgaatttcttgtgctcagtgaggtgggcagcaaggat
gcggaattagcaagccggcaaagctctgaggaatggcttgaatatatcgttgaggatatg
gaagcgggcgcggaaaaagtgattacagaagccagagaaagcggaacgggagggatctgt
tccagcagcggcgatgtcaggtttcaaattgttgacgacatcatttcctcggatattgat
atcaacaggctgatttttgaagcgcctaacaaaacgcttcagcaagggtttattcaaaaa
atcgggccgaatgtgaatcttgccaatattccatttcatgatgccatcgcgttggaaacg
ctgcgtttagggctaagatccgataccttttttctgtaa

DBGET integrated database retrieval system