KEGG   Bacillus subtilis subsp. subtilis 168: BSU10970
Entry
BSU10970          CDS       T00010                                 

Gene name
yitF
Definition
(RefSeq) isomerase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MR_MLE_C MR_MLE_N
Other DBs
NCBI-GeneID: 939345
NCBI-ProteinID: NP_388978
Pasteur: BG13111
BSORF: BG13111
UniProt: O06741 A0A6M4JHA3
Structure
PDB: 
2GDQ 2GGE

Position
complement(1174861..1175976)
AA seq 371 aa
MKIVRIETFPLFHRLEKPYGDANGFKRYRTCYLIRIITESGIDGWGECVDWLPALHVGFT
KRIIPFLLGKQAGSRLSLVRTIQKWHQRAASAVSMALTEIAAKAADCSVCELWGGRYREE
IPVYASFQSYSDSPQWISRSVSNVEAQLKKGFEQIKVKIGGTSFKEDVRHINALQHTAGS
SITMILDANQSYDAAAAFKWERYFSEWTNIGWLEEPLPFDQPQDYAMLRSRLSVPVAGGE
NMKGPAQYVPLLSQRCLDIIQPDVMHVNGIDEFRDCLQLARYFGVRASAHAYDGSLSRLY
ALFAQACLPPWSKMKNDHIEPIEWDVMENPFTDLVSLQPSKGMVHIPKGKGIGTEINMEI
VNRYKWDGSAY
NT seq 1116 nt   +upstreamnt  +downstreamnt
gtgaaaattgtacggattgaaacctttccgctatttcatcgattagaaaagccatacgga
gatgccaatgggtttaaacgatatcggacttgttatctcatcaggattatcaccgaaagc
gggatagacggctggggagaatgcgttgattggctccctgctctccatgtcggttttacg
aagcggatcatcccatttctattaggaaaacaggctggcagccgcctgtcattagtgcgc
acgattcaaaaatggcaccagcgggcggcctccgctgtaagcatggcgctgacagagatt
gcagccaaagctgcggattgttcggtttgcgaattatggggcgggcgatacagagaggag
attcctgtgtacgcgtcttttcaatcgtactcagactccccgcaatggatcagccgctca
gtctccaatgttgaagcccagttgaaaaaaggttttgagcaaatcaaagtcaaaattggc
gggacttcattcaaggaggatgtccggcacatcaatgcgctgcagcatacagcaggcagc
tccattacgatgattctggacgcaaaccaaagctacgatgccgctgcggcttttaaatgg
gagcgctatttctccgaatggacgaacattggctggcttgaggagcctttgccctttgat
cagccgcaggattacgctatgcttcgaagccgtttgtctgttcctgttgccggcggagaa
aacatgaaaggcccggcgcaatatgtgcctctcctttcacagcgctgtttggatatcatt
cagcccgatgtcatgcatgtcaacggaattgatgagtttcgggactgcctccagctcgcg
cgttatttcggcgtcagagcatccgcccatgcatatgacggatcgctctcacggctctat
gctttatttgcacaagcctgtctgcccccatggtctaaaatgaagaacgatcacattgaa
ccgatcgagtgggacgtcatggagaatccttttacagatctcgtcagcctgcagccttca
aaaggaatggtccacatcccgaaaggaaaaggcattggcacagagatcaatatggagatc
gtcaatcgctacaagtgggatggctcagcctattaa

DBGET integrated database retrieval system