KEGG   Bacillus subtilis subsp. subtilis 168: BSU10990
Entry
BSU10990          CDS       T00010                                 

Gene name
yitH
Definition
(RefSeq) N-acetyltransferase YitH
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Acetyltransf_18 Acetyltransf_10 Acetyltransf_1 Acetyltransf_7 FR47
Other DBs
NCBI-GeneID: 936361
NCBI-ProteinID: NP_388980
Pasteur: BG13113
BSORF: BG13113
UniProt: O06743 A0A6M3Z9B4
Position
complement(1177365..1178213)
AA seq 282 aa
MDVVDELIKLHEEHVSGLLRLCGQAGWPDYGEQELKLLVQQGRFFGYQNVSGDIISCIGL
FLFGRLTSIGLVIVDKEYQRLGLGRRMVNACITQTDENTAIRLCATKEGLPLYEKAGFHT
AGSVRKYSCHSFQPYTKKLDAELTSFREQDFHDLTAADLAAFGGDRSNLLQQLISASCEC
IIARNQDGQLIGYGLSVQTPANLKFGPIIAPSSDVAAQIITRLAAGKQGPMRIDIPSEHT
SLHDSLIEMGFHKDDEPPILFYQKKAPIQNGHLYALISQALG
NT seq 849 nt   +upstreamnt  +downstreamnt
atggacgtagtagatgaactgattaagcttcatgaagaacacgtttccggcttattgcgg
ctttgcgggcaagccgggtggccggattatggcgaacaagagctgaaactgcttgttcag
cagggacgctttttcggttatcaaaatgtcagcggtgatattatttcctgcatcggcttg
tttttgtttggccgtcttacttctatcggccttgttatcgttgacaaggaatatcaacgg
ctcggtcttggccggcgtatggtaaacgcctgtattacccaaacggatgaaaacaccgcc
atcaggctttgcgccacaaaagaaggtttgccgctttatgaaaaagcaggttttcatacg
gcaggttcagtgcgaaagtacagctgtcacagttttcaaccttatacaaaaaagcttgat
gctgaactgacatcctttagagaacaagactttcacgacttaaccgcggcggatctggct
gcctttggcggagatcgatcaaaccttttgcagcagcttatttctgcttcatgcgaatgt
atcatcgccagaaatcaggacggacagctcattggctacggactttctgtacagacaccg
gccaatttgaaattcggccctatcatcgctccatcatcagatgttgcagcacagataatt
acaaggctggcggccggcaaacaagggccgatgcgaatcgatataccgagtgaacacacg
tctctgcatgacagcctgatagaaatgggatttcataaagatgatgaacctccgattttg
ttctatcagaaaaaagcgcctattcaaaatggacacttatatgctttgatttcacaggct
ctcggttaa

DBGET integrated database retrieval system