KEGG   Bacillus subtilis subsp. subtilis 168: BSU11000
Entry
BSU11000          CDS       T00010                                 

Symbol
yitI
Name
(RefSeq) N-acetyltransferase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Acetyltransf_10 Acetyltransf_1 Acetyltransf_7 Acetyltransf_9
Other DBs
NCBI-GeneID: 939344
NCBI-ProteinID: NP_388981
Pasteur: BG13114
BSORF: BG13114
UniProt: O06744 A0A6M4JIJ6
Position
complement(1178218..1178682)
AA seq 154 aa
MRRNIMLEVKTISVEDTYEIRHRILRPHQSIEQCKYKEDHAEGSFHLGVFYDGTLISIAS
FSPQSQPLLTEASAYRLRGMATLEGYRDQKAGSTLIKHAEHKLAESGVQAVWCNARHHVK
GYYAKLGWKELGEPFDIPGIGNHIVMYKTLRTSR
NT seq 465 nt   +upstreamnt  +downstreamnt
atgaggaggaacattatgctcgaagtcaaaaccatttccgtggaagatacatatgaaatc
cggcatcgcattctgcgtccccatcaatccatcgaacaatgcaaatataaagaggatcac
gcagaaggctcctttcatctcggcgtgttttatgatggaacgctgatcagcatcgcttct
ttttccccgcaaagtcagcctttattaacggaagcctctgcgtatcggctgagaggcatg
gcaacgctcgagggatatcgcgatcaaaaagctggaagcacgctgatcaaacacgcggag
cacaaactggcggagagcggcgttcaggcggtatggtgcaacgcaagacaccatgtcaag
ggctactatgccaagcttggctggaaggaacttggcgaaccatttgacattcccggcatt
ggcaatcatattgtcatgtacaaaacacttagaacaagcaggtga

DBGET integrated database retrieval system