KEGG   Bacillus subtilis subsp. subtilis 168: BSU11010
Entry
BSU11010          CDS       T00010                                 

Gene name
yitJ
Definition
(RefSeq) bifunctional homocysteine S-methyltransferase/5,10-methylenetetrahydrofolate reductase
  KO
K24042  methionine synthase / methylenetetrahydrofolate reductase (NADH) [EC:2.1.1.13 1.5.1.54]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00270  Cysteine and methionine metabolism
bsu00450  Selenocompound metabolism
bsu00670  One carbon pool by folate
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01230  Biosynthesis of amino acids
Module
bsu_M00017  Methionine biosynthesis, aspartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSU11010 (yitJ)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BSU11010 (yitJ)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BSU11010 (yitJ)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.54  methylenetetrahydrofolate reductase (NADH)
     BSU11010 (yitJ)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.13  methionine synthase
     BSU11010 (yitJ)
SSDB
Motif
Pfam: S-methyl_trans MTHFR ExbD DUF6506
Other DBs
NCBI-GeneID: 939796
NCBI-ProteinID: NP_388982
Pasteur: BG13115
BSORF: BG13115
UniProt: O06745 A0A6M4JF47
Position
complement(1178757..1180595)
AA seq 612 aa
MGLLEDLQRQVLIGDGAMGTLLYSYGIDRCFEELNISKPEEIQRIHKAYVEAGANIIQTN
TYGANYIKLSRHGLEDDIKKMNQEAVKIARASAGDAYVLGTMGGIRTFNKNAYSLDEIKR
SFREQLYLLLHEEPDGLLLETYYDLEEAREVLKIARKETDLPIMLNVSMHEQGVLQDGTP
LSDALRSIADLGADIVGINCRLGPYHMIEALSEVPIFDDVFLSVYPNSSLPSLEEGRLVY
ETDDTYFQNSASEFRKQGARIIGGCCGTTPNHIRAMAEAVGGLAPITEKEVKTRAKEFIS
VHHERTEPGLDEIAAKKRSIIVELDPPKKLSFDKFLSAAAELKEAGIDALTLADNSLATP
RISNVACGALVKQQLDMRSLVHITCRDRNIIGLQSHLMGLDTLGLNDVLAITGDPSKIGD
FPGATSVYDLTSFDLIRLIKQFNEGLSLSGKPLGKKTNFSVAAAFNPNVRHLDKAVKRLE
KKIDCGADYFVSQPVYSEQQLVDIHNETKHLKTPIYIGIMPLTSSRNAEFIHNEIPGIKL
SDTIREKMAHAGEDKEKQKAEGLAIARSLLDTACELFNGIYLITPFLRSDLTAELTSYIQ
QKDEQRQNIFLH
NT seq 1839 nt   +upstreamnt  +downstreamnt
atgggacttttagaagatttgcaaagacaggtgttaatcggtgacggcgccatggggacg
ctcctctactcctatggcattgacaggtgttttgaggagctcaatatttcaaagccggag
gaaattcagcgcatacataaagcgtacgttgaagcgggagccaacattattcaaacgaat
acgtacggagccaactatattaaattatccagacacgggcttgaggatgacatcaaaaaa
atgaatcaggaggccgtaaagatcgcgcgggcttcagcaggcgatgcatacgtgcttgga
acgatgggcggcatacgcacatttaataaaaacgcatacagtcttgacgaaattaagcgc
agcttccgcgagcagctgtatctgctgctgcatgaagagccggatggcttgctgttagaa
acatattatgatttggaagaagcccgtgaagtgctgaaaatcgcgcgcaaagagactgat
cttccgattatgctcaatgtctccatgcacgagcaaggcgtattgcaggacggaacgccg
ctttctgacgcattgcgctcgattgcggatctcggagctgatattgtcggcattaactgc
cgcctcggcccttatcacatgattgaagcgctaagcgaagtgccgatttttgatgacgta
ttcttatccgtttatccgaacagcagtcttccttcgcttgaagagggacggctcgtctat
gaaacagacgacacgtattttcaaaacagcgcgtcagaattccgtaagcaaggtgcgcgg
attatcggcggctgctgcggcacaacgccgaatcacatcagggcgatggcggaagcggtt
ggcgggctggctccgattacggaaaaagaagtcaaaacccgggcgaaagaattcatttct
gttcatcacgagcgaaccgagcccggcctggatgagatcgcagcgaaaaaacgctctatt
atcgtagagctggacccgccgaaaaaactaagctttgacaaatttctgtccgctgctgct
gaattaaaagaagcgggaatcgatgccctgacactcgccgacaattctttggcgaccccg
cggatcagcaatgttgcctgcggcgcccttgtcaagcagcagctcgatatgcgttccctt
gtccatattacgtgccgtgaccgtaacattatcggcttacagtcacatttaatgggcctt
gatacgttagggctgaatgacgtgcttgctattacaggtgacccttctaaaatcggggat
tttcctggggcgacgtctgtatatgatttaacatcttttgatttaatcaggctgatcaaa
caattcaatgaaggtctgtctctgtctggaaaaccgctcggcaagaaaacgaatttctca
gttgccgccgcatttaatcctaacgtccgccatctggataaagcggtaaaacggcttgag
aaaaaaatagattgcggcgcagattattttgtttctcagcctgtctattccgagcagcag
cttgtcgatatccataacgaaacaaaacatctgaagacgccgatctatatcggcatcatg
ccgctgacaagcagccggaatgccgaattcatccataatgaaattcccggcattaagctg
tctgatacgattcgcgaaaaaatggcccatgccggtgaagataaagaaaagcaaaaggcg
gaaggccttgcaattgcacgctccctgctggatacggcatgcgagctgtttaacggcatc
tacttgataacgcctttcctcagatctgacttaaccgctgagctcacatcatatattcag
caaaaagatgagcagcgccaaaatatctttttgcattaa

DBGET integrated database retrieval system