KEGG   Bacillus subtilis subsp. subtilis 168: BSU11020
Entry
BSU11020          CDS       T00010                                 

Symbol
yitK
Name
(RefSeq) hypothetical protein
  KO
K09767  cyclic-di-GMP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    BSU11020 (yitK)
SSDB
Motif
Pfam: DUF520 DNA_pol3_beta_2 RRF
Other DBs
NCBI-GeneID: 936375
NCBI-ProteinID: NP_388983
Pasteur: BG13116
BSORF: BG13116
UniProt: O06746 A0A6M4JLW7
Position
complement(1180909..1181400)
AA seq 163 aa
MAKESSFDIVSKVELPEVQNAIQIALKEISTRYDFKGSKSDISLDKEELVLVSDDEFKLS
QLKDVLVSKLIKRNVPTKNIDYGKVENASGGTVRQRAKLVQGIDKDNAKKINTIIKNSGL
KVKSQVQDDQVRVTGKNKDDLQQIISAVRGADLPIDVQFINFR
NT seq 492 nt   +upstreamnt  +downstreamnt
atggcaaaagaaagttcatttgatattgtatccaaggtggaattgcctgaagtgcaaaac
gcaatccaaatcgcactgaaggaaatcagtacccgatatgactttaaaggcagcaaaagc
gacatttctttagataaagaggagctggtcctcgtttccgatgacgaattcaaattaagc
cagctgaaagatgtgctggtcagcaaattgattaaacgaaacgtaccgacaaaaaacatt
gattacggcaaggttgaaaacgcgtcaggcggaacggtgcgccagcgtgcaaagcttgtt
caaggcattgacaaggacaacgcaaaaaaaatcaatacgatcatcaaaaactccggactg
aaagtaaagtctcaggtgcaggatgatcaagtgcgtgtcaccggaaaaaacaaagatgac
ctgcagcagattatctcagctgtacggggagcagatctgccaattgacgttcaatttata
aatttcagataa

DBGET integrated database retrieval system