KEGG   Bacillus subtilis subsp. subtilis 168: BSU11030
Entry
BSU11030          CDS       T00010                                 

Gene name
yitL
Definition
(RefSeq) hypothetical protein
  KO
K00243  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU11030 (yitL)
SSDB
Motif
Pfam: S1_2 CvfB_WH S1
Other DBs
NCBI-GeneID: 939792
NCBI-ProteinID: NP_388984
Pasteur: BG13117
BSORF: BG13117
UniProt: O06747 A0A6M4JKC6
Position
1181499..1182395
AA seq 298 aa
MLTKSAENKRNRKDDSMRPGQQLTLSIDHQTDFGYFLTDGEDTILLHNSEMTEDIEDRDE
VEVFIYVDQQERLAATMKIPIISADEYGWVEVVDKVEDMGVFVDVGLSKDALVATEHLPP
YEDVWPQKGDKLYCMLKVTNRGRMFAKPAPEDIISELFTDASEDLMNKELTGTVYRLIAS
GSFVITDDGIRCFIHPSERKEEPRLGSRVTGRVIQVKEDGSVNLSLLPRKQDAMSVDAEC
ILTYMRMRNGAMPYSDKSQPDDIRERFNMSKAAFKRALGHLMKNGKVYQENGWTYEKK
NT seq 897 nt   +upstreamnt  +downstreamnt
atgttaacaaaatccgcagagaataagcggaacaggaaggacgatagcatgagaccaggg
cagcaattaaccttgagtatagatcaccaaaccgacttcggttactttttaaccgatggg
gaagatacgattctcttacataacagtgaaatgactgaggatatcgaggacagagacgaa
gtagaagtctttatatacgtagaccagcaggaaaggcttgcggccacgatgaaaattccg
atcatcagcgcggatgaatatggctgggttgaagtggtggataaagtggaagatatgggc
gttttcgttgatgtcggtttatcgaaggacgcactagtcgcaactgagcatttgccgccg
tacgaagatgtctggccgcaaaaaggggacaaactttactgtatgctgaaggtgacgaac
cgggggcgcatgtttgcgaaaccagcgccggaagatatcatcagcgaactgtttaccgac
gcttcagaagatctgatgaataaagagctgacaggtacggtgtacaggctgatcgcatcg
ggttcattcgtgatcacggatgacggtatccgctgttttattcacccgtcagaaagaaaa
gaggagccaagactgggttcaagagtcacaggccgggtgattcaagtgaaagaagacggt
tcagtcaacttgtcgctgcttccgagaaaacaggatgcaatgtcagttgatgctgagtgc
attctaacgtatatgagaatgagaaacggtgccatgccgtacagtgacaaaagccagcct
gacgatatcagagaacgttttaatatgagcaaagccgcctttaaacgcgcgctgggccat
ttgatgaaaaacggaaaagtgtatcaggaaaatggatggacatacgagaaaaaatag

DBGET integrated database retrieval system