KEGG   Bacillus subtilis subsp. subtilis 168: BSU11040
Entry
BSU11040          CDS       T00010                                 

Gene name
yitM
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Imm42
Other DBs
NCBI-GeneID: 936374
NCBI-ProteinID: NP_388985
Pasteur: BG13118
BSORF: BG13118
UniProt: O06748 A0A6M4JES7
Position
complement(1182448..1183032)
AA seq 194 aa
MKKAFLVFLSVVLVTTVFLVKQQESVAQAKQLEYSGEEIFKGFVFAQGEVGKQLPEVFNK
AMTDKLNTKQAKAFANQVVADIKKEDADFFDNLKKAVYSKDALKVDELLKKAGQIVEEKV
EAAKEIAASKDDTSRVQAELVNTVDTANYFYYVSYVAAAGALILIILAIDITPIAISDNV
DREMAIRTLVDELN
NT seq 585 nt   +upstreamnt  +downstreamnt
ttgaagaaggcgtttctagtatttttgtcggttgtattggtgacgactgtgtttttggtg
aagcagcaagaaagtgtggcacaggcaaagcagcttgagtattcaggtgaggaaattttt
aaaggctttgtgtttgcccaaggggaagttggcaaacagcttccagaggtctttaataaa
gcgatgacagacaaactcaacacaaaacaggcaaaggcttttgccaatcaggttgtcgct
gatattaaaaaagaggatgctgacttttttgataacctgaagaaagctgtttacagcaaa
gatgcattgaaagtggatgaactgctgaaaaaagcaggtcaaatcgttgaagaaaaagta
gaagctgcaaaggaaatcgccgcttctaaggatgatacatccagagttcaggccgagctt
gtcaacactgttgataccgctaactatttctattatgtttcttatgttgctgcagcaggt
gccctgattctgatcattctcgccattgatattacgccgattgcgatttcagacaatgtg
gatcgcgaaatggcaatcagaacgctggttgatgaattaaactag

DBGET integrated database retrieval system