KEGG   Bacillus subtilis subsp. subtilis 168: BSU11055
Entry
BSU11055          CDS       T00010                                 

Gene name
yitO
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: VKG_Carbox LMF1 EMC6
Other DBs
NCBI-GeneID: 936373
NCBI-ProteinID: NP_388987
UniProt: O06750 A0A6M3Z9J5
Position
complement(1183029..1183958)
AA seq 309 aa
MLENIKQTITRWDERNPWTNVYGLARSIIALSSLLTLLINHPSLIMKPASGISSYPACKM
NLSLFCLGENNYMMLNLFRWVCIAILVLVVIGWRPRITGVLHWYVSYSLQSSLIVIDGGE
QAAAVMTFLLLPITLTDPRKWHWSTRPIEGKRTLGKITAFISYFVIRIQVAVLYFHSTVA
KLSQQEWVDGTAVYYFAQEKTIGFNGFFQALTKPIVTSPFVVIPTWGTLLVQIVIFAALF
APKKHWRLILIIAVFMHEIFAVMLGLISFSIIMAGILILYLTPIDSTIQFTYIRRLLWNK
KHKKGEVSV
NT seq 930 nt   +upstreamnt  +downstreamnt
atgctcgaaaacataaaacagaccatcaccagatgggacgaaagaaacccgtggacaaat
gtatatggcctcgcgcgaagcatcattgcgctatccagcctgctgacgctgctcatcaat
cacccgagcctcattatgaagccagccagcgggatcagcagctatccagcttgtaaaatg
aatctcagtctcttttgtctcggcgaaaataactatatgatgttaaatcttttcagatgg
gtctgcattgccattctggtgcttgttgtcattggctggcgccccagaatcaccggggtt
ctgcattggtatgtcagttacagcctgcagtcatcgctgatcgtcatcgacggaggcgag
caggcagcagcagtcatgacctttttattgcttcccatcacgctgaccgatccgagaaaa
tggcattggagtacgagacctatagagggcaaaagaacacttggaaaaataacagctttt
atttcttattttgtgatcagaatccaagtggcggtgctttattttcactctaccgtcgct
aagctatctcagcaggaatgggtggacggaacggccgtctattatttcgcccaggaaaaa
accattggcttcaacggcttttttcaggcgttaacgaagccaattgtaacaagtccgttc
gtggtgattccgacatgggggacgctgctggttcaaattgtcatcttcgcggcactgttt
gcgccgaagaagcattggagattgattttgatcatcgctgtttttatgcatgagattttt
gcagtcatgctgggcctcatcagtttttcgattatcatggccggcattttgatattgtat
ctcactcctatcgattccacgattcaatttacatatattcgcagactgttgtggaataaa
aaacacaagaagggagaggtttcagtttga

DBGET integrated database retrieval system