KEGG   Bacillus subtilis subsp. subtilis 168: BSU11070
Entry
BSU11070          CDS       T00010                                 

Gene name
yitP
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: SdpA UnbV_ASPIC
Other DBs
NCBI-GeneID: 939348
NCBI-ProteinID: NP_388988
Pasteur: BG13121
BSORF: BG13121
UniProt: O06751 A0A6M4JGX0
Position
complement(1183943..1184479)
AA seq 178 aa
MQKSISFFVIFSILWGSLFLFSIIGSLGTTPIPLTKDSKFLMSSILPQGWGFFSKNPRDT
AIGLYEAENASAKVRWPNMRADNLFGLYRYGRSQGVEMGVIYSQVGKEQWTACKEKDLGA
CKSKAKTVQLKTPAPRPLLCGSYYLTKEDIVPWSYSKYTPSSYQVKSIVKVVISCSKT
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcagaaatcgatatcattttttgtcattttttcaatcctttggggttcgctatttctg
ttttctattattggcagcttagggacaaccccgattccgctgacaaaggactccaaattt
ctcatgtccagcatcctccctcagggctggggcttttttagcaaaaatccgcgtgatact
gcaatcggcttatatgaggctgaaaatgccagcgccaaggtcagatggcccaatatgagg
gctgacaacctattcggcctgtatcggtatgggcggtcacaaggcgttgaaatgggcgtg
atctacagccaagtcggcaaggaacagtggacagcatgtaaagaaaaggacctcggcgca
tgcaaaagcaaagccaaaaccgtgcaattaaaaacacccgctccccgcccgctgctttgt
ggcagctactatttgacgaaagaggatattgttccttggagctattctaaatatacccct
tcgtcttatcaggtaaaaagcatagtcaaggttgtgatctcatgctcgaaaacataa

DBGET integrated database retrieval system