KEGG   Bacillus subtilis subsp. subtilis 168: BSU11079
Entry
BSU11079          CDS       T00010                                 

Gene name
yizB
Definition
(RefSeq) DNA-binding protein YizB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: PadR HTH_34 SgrR_N TrmB HTH_45
Other DBs
NCBI-GeneID: 8302950
NCBI-ProteinID: YP_003097701
UniProt: C0H3Y4 A0A6M4JHB1
Position
1184657..1185004
AA seq 115 aa
MKTNQVNDRWIVQFRKGIFELAILSLLRSKPMYGYELTSSLKTTSALAISEGAIYPILKR
MTEKGWIEFFWEDSLDGPKRKYYKMTQKGEEMLKERLEKYLETHQALLSLSGDLL
NT seq 348 nt   +upstreamnt  +downstreamnt
atgaaaacgaatcaagttaatgaccgctggattgttcaatttcgaaaagggattttcgag
ctggccatcctatcccttctgcgttctaaaccgatgtacggttatgagctgacgtcatcc
ttaaaaaccacctcggcgctggctatttcagagggagcgatttatccgattttgaaacgt
atgaccgagaagggatggatcgaatttttttgggaagattcactggacggcccgaaaaga
aagtattacaaaatgacgcaaaaaggagaagaaatgttaaaagaacggctggagaaatac
ctggaaacccatcaagccttactgtctttatcgggggatttgctatga

DBGET integrated database retrieval system