KEGG   Bacillus subtilis subsp. subtilis 168: BSU11080
Entry
BSU11080          CDS       T00010                                 

Gene name
yitQ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: VIT1 DUF1304 Spectrin_like DUF1700
Other DBs
NCBI-GeneID: 939797
NCBI-ProteinID: NP_388989
Pasteur: BG13122
BSORF: BG13122
UniProt: O06752 A0A6M3Z9A7
Position
1185001..1185588
AA seq 195 aa
MNGQLIIDRYMEELNAELANMPDVERENAIDELKGHITAFVQDRIKAGLSEEELQEAVES
EFSHPKELAELMMGDGGETKRRRSLLGKSWISVLLIVTIIALPLLPSDFRHLPLAVYLMV
LAGYVWKRKKLVMFAGVRKNKMRSQKEIVKISRVGAVYLLFLAVVLLLSPFLNALVVLLL
IAVSCAAFFLFLNIK
NT seq 588 nt   +upstreamnt  +downstreamnt
atgaatggacagcttatcattgaccgatacatggaggaactaaatgcagagctggcgaat
atgcctgatgtagagagagaaaacgctatcgacgaattaaaggggcatatcaccgctttc
gttcaagacagaatcaaagccggccttagtgaagaggaactgcaggaagctgttgaatct
gaattttctcatccgaaggagcttgccgaattgatgatgggtgatgggggagagacgaaa
aggaggaggtctttattgggcaaaagctggatttcggtccttctcattgtcacgattatc
gccctgccgctgctgccgtccgacttcagacatctgccgctggctgtttatttaatggtg
ctcgccggatatgtatggaagcggaaaaaattggtgatgtttgcaggtgtcagaaaaaac
aaaatgcgctctcaaaaggagattgtcaagatttcgcgagtcggtgcggtttatctgctg
tttttagcagtggtgctccttttgagcccgttcctcaatgcgcttgtcgtcctgctgctg
attgcagtaagctgcgccgctttttttctttttcttaacatcaagtaa

DBGET integrated database retrieval system