KEGG   Bacillus subtilis subsp. subtilis 168: BSU11100
Entry
BSU11100          CDS       T00010                                 

Symbol
nprB
Name
(RefSeq) neutral protease B
  KO
K08777  neutral peptidase B [EC:3.4.24.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU11100 (nprB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU11100 (nprB)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     BSU11100 (nprB)
Peptidases and inhibitors [BR:bsu01002]
 Metallo peptidases
  Family M4: thermolysin family
   BSU11100 (nprB)
SSDB
Motif
Pfam: Peptidase_M4_C Peptidase_M4 PepSY FTP
Other DBs
NCBI-GeneID: 936384
NCBI-ProteinID: NP_388991
Pasteur: BG10691
BSORF: BG10691
UniProt: P39899 A0A6M4JIK0
Position
1186037..1187653
AA seq 538 aa
MRNLTKTSLLLAGLCTAAQMVFVTHASAEESIEYDHTYQTPSYIIEKSPQKPVQNTTQKE
SLFSYLDKHQTQFKLKGNANSHFRVSKTIKDPKTKQTFFKLTEVYKGIPIYGFEQAVAMK
ENKQVKSFFGKVHPQIKDVSVTPSISEKKAIHTARRELEASIGKIEYLDGEPKGELYIYP
HDGEYDLAYLVRLSTSEPEPGYWHYFIDAKNGKVIESFNAIHEAAGTGIGVSGDEKSFDV
TEQNGRFYLADETRGKGINTFDAKNLNETLFTLLSQLIGYTGKEIVSGTSVFNEPAAVDA
HANAQAVYDYYSKTFGRDSFDQNGARITSTVHVGKQWNNAAWNGVQMVYGDGDGSKFKPL
SGSLDIVAHEITHAVTQYSAGLLYQGEPGALNESISDIMGAMADRDDWEIGEDVYTPGIA
GDSLRSLEDPSKQGNPDHYSNRYTGTEDYGGVHINSSIHNKAAYLLAEGGVHHGVQVEGI
GREASEQIYYRALTYYVTASTDFSMMKQAAIEAANDLYGEGSKQSASVEKAYEAVGIL
NT seq 1617 nt   +upstreamnt  +downstreamnt
ttgcgcaacttgaccaagacatctctattactggccggcttatgcacagcggcccaaatg
gtttttgtaacacatgcctcagctgaagaaagcatcgaatacgaccatacgtatcaaacc
ccttcatacatcatcgaaaagtcaccgcagaagccggtacaaaacacaacccagaaagaa
tcgctattttcctatcttgacaagcatcaaacgcagtttaagctcaaagggaatgcgaac
agccattttcgcgtttcgaaaaccataaaggatccaaagacaaaacaaacgttttttaaa
ttaacggaggtttacaaaggaattccgatttacggctttgaacaagcggtcgcgatgaag
gaaaacaaacaagtgaaaagtttctttggaaaggtgcatccgcaaatcaaggacgtctcc
gtcacaccgtctatttctgagaaaaaagcaatacatacagcaaggcgtgagctcgaggct
tccattggaaaaatcgaatatcttgatggggaaccaaaaggcgaattatatatctatcca
cacgacggtgaatatgatctcgcctaccttgtgagactctcgacatctgaacctgagcct
ggctattggcattatttcatcgatgccaaaaacggaaaggtcatcgagtcctttaatgcc
attcatgaagcggcaggtacaggaatcggcgtgtcaggtgatgaaaaaagctttgacgtc
acagaacaaaatgggcgcttttatttggctgacgaaacaaggggaaaagggatcaataca
tttgacgcgaagaacctgaacgaaaccttgtttacgcttttgtctcaactgatcgggtat
acgggcaaagaaatagtcagcggcacgtccgtatttaatgaacctgcggctgtagacgca
cacgcaaatgcgcaagccgtttacgattattacagcaagacatttggccgtgattctttt
gatcaaaacggagcaaggattacgtctaccgtgcatgtcggcaaacaatggaacaatgct
gcgtggaacggtgtccagatggtatacggggatggagacggttcgaaatttaagccgctg
tctggatcgctcgacattgtcgcgcatgaaatcacacacgcagtcacacagtattccgcc
ggtcttttatatcaaggagaacccggtgcattaaatgagtccatttctgacattatgggc
gcgatggctgaccgtgatgattgggagatcggcgaagatgtctatactcctggtattgca
ggagattcattgcggtcattggaggacccatctaagcagggaaatccagatcattactcg
aaccgctacacaggaacagaggattatggcggagtccatatcaattcgtccattcacaat
aaagcagcttatcttcttgcagaaggaggcgtgcaccacggtgtacaggttgaagggatt
gggcgtgaagcaagtgaacaaatttactatcgggctttaacatattatgtaacggcatct
acagatttcagcatgatgaagcaagcggcgattgaagctgccaatgatttatacggtgaa
ggctcgaagcaatcagcttcagtcgaaaaggcgtatgaggctgtcggcattctatga

DBGET integrated database retrieval system