KEGG   Bacillus subtilis subsp. subtilis 168: BSU11110
Entry
BSU11110          CDS       T00010                                 

Gene name
yitS
Definition
(RefSeq) Degv domain-containing protein YitS
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DegV Dak1_2 Ribonuc_L-PSP
Other DBs
NCBI-GeneID: 936376
NCBI-ProteinID: NP_388992
Pasteur: BG12244
BSORF: BG12244
UniProt: P70945 A0A6M4JF57
Position
complement(1187700..1188551)
AA seq 283 aa
MTVHLIADSATDLPRSYFEEKGIGFIPLRVSLGDKEFEDAVTIHADQIFEAMQNGETPKT
SQASPQTIKNVFLQYAETGDPALYIAFSSGLSGTYQTAVMIANEVKEEFPDFDLRVIDSK
CASLGYGLAVRHAADLCINGNTIQEIETSVKNFCSQLEHIFTVDDLTYLARGGRISKTSA
FVGGLLNIKPLLQMEDGKLVPLEKIRGQKKLFKRIIELMKERGDDWSNQTVGISYAANKE
KATDMKHLIEEAFKPKEIIMHPISSAIGSHAGPGTLAIFFLRK
NT seq 852 nt   +upstreamnt  +downstreamnt
atgacagttcatctcatcgctgacagcgccactgatttgcctcgttcttattttgaagaa
aaaggcattggctttattccgctcagggtttctctcggcgataaagaattcgaagatgca
gtcacaattcatgcggatcaaatatttgaagcgatgcaaaatggagaaacgcctaagacg
tcccaagcctcaccgcaaacgattaaaaatgtgtttttgcaatatgccgaaacaggtgat
cccgctctttacattgccttttcctcaggtctctccggcacgtatcagacagctgtaatg
atcgccaatgaagtgaaggaggaattccccgatttcgatttgcgggtcattgattccaaa
tgcgcttcattaggatacggtctggctgtccggcatgctgccgatctctgtatcaacggg
aatacaatacaagaaattgaaacgtctgtaaagaacttttgcagccagcttgaacacatt
tttaccgttgatgatttaacatatctcgcgaggggcggccggatatccaaaacgtccgct
tttgtcggcggcctgttgaatattaaaccgctgcttcagatggaggacggcaagcttgtg
cctctggaaaaaattcgcggacagaagaaacttttcaaacggatcatcgagcttatgaaa
gagcgcggggatgattggagcaatcaaaccgtcgggattagctacgccgcgaacaaagaa
aaagccacggatatgaaacacctgattgaggaagcgttcaagccgaaagaaatcattatg
catccaatcagttcagccatcggctcgcatgccggtccaggtacattggcgatattcttt
ttaagaaaatga

DBGET integrated database retrieval system