KEGG   Bacillus subtilis subsp. subtilis 168: BSU11120
Entry
BSU11120          CDS       T00010                                 

Gene name
yitT
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YitT_membrane DUF2179
Other DBs
NCBI-GeneID: 939346
NCBI-ProteinID: NP_388993
Pasteur: BG10850
BSORF: BG10850
UniProt: P39803 A0A6M3ZEM6
Position
1188689..1189531
AA seq 280 aa
MVLDQTKKLLIVIIGALLNAAGLNLFLIPADVYASGFTGVAQLLSSVVDQYAPFYISTGT
LLFLLNIPVGILGWLKVGKSFTVYSILSVALTTLFMGILPETSLSHDILLNAVFGGVISA
VGIGLTLKYGASTGGLDIVAMVLAKWKDKPVGTYFFILNGIIILTAGLLQGWEKALYTLV
TLYVTTRVIDAIHTRHMKLTAMIVTKKADEIKEAIYGKMVRGITTVPAKGAFTNEQKEMM
IIVITRYELYDLEKIVKEVDPKAFTNIVQTTGIFGFFRKD
NT seq 843 nt   +upstreamnt  +downstreamnt
atggtactagatcaaacaaaaaaattactcatcgtcatcatcggcgctttactcaatgct
gccgggctgaacttatttttgatacctgcagatgtatatgccagcggatttacaggtgtt
gcccagcttttatcaagcgtcgttgatcaatatgcccccttttacatatcgacgggaacg
ctcttgttcctcttaaacattccggtcggtattttaggatggctgaaggtcggcaaatcg
tttacagtgtacagcattttaagtgtcgcactcactactctgtttatggggatcctgccg
gaaacaagcctgtcacatgacattttgctgaacgcggtgttcggcggcgtcatttccgca
gtcggtatcggcttaacattaaaatacggagcttcgacaggcgggcttgatatcgtcgcc
atggtacttgcaaagtggaaggataaacccgtcggcacgtatttcttcattctgaacggg
attatcatcttgacggcaggattattgcaaggttgggagaaagcattatataccctggtt
acactatatgtgacaacgagggtgatcgacgccattcacactcgccacatgaagcttacg
gcaatgattgtgacgaaaaaagcggacgaaatcaaggaagccatttacggaaaaatggtg
cgcggcatcacaactgttccggcaaaaggagcatttacgaacgaacagaaagaaatgatg
attatcgtcatcacgaggtatgaactgtacgatttagaaaagatcgtcaaagaagttgat
ccaaaagcatttacgaacatcgttcaaacgacagggatttttggtttctttagaaaagac
tga

DBGET integrated database retrieval system