KEGG   Bacillus subtilis subsp. subtilis 168: BSU11130
Entry
BSU11130          CDS       T00010                                 

Symbol
ipi
Name
(RefSeq) intracellular proteinase inhibitor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: BsuPI Lectin_like Auxin_inducible Filamin
Other DBs
NCBI-GeneID: 936380
NCBI-ProteinID: NP_388994
Pasteur: BG10852
BSORF: BG10852
UniProt: P39804 A0A6M3ZIW0
Structure
PDB: 
3ISY

Position
1189646..1190005
AA seq 119 aa
MENQEVVLSIDAIQEPEQIKFNMSLKNQSERAIEFQFSTGQKFELVVYDSEHKERYRYSK
EKMFTQAFQNLTLESGETYDFSDVWKEVPEPGTYEVKVTFKGRAENLKQVQAVQQFEVK
NT seq 360 nt   +upstreamnt  +downstreamnt
atggagaatcaagaggttgttttatctattgacgcaattcaggagcctgaacaaatcaag
tttaacatgtcgctgaagaaccaaagcgaacgtgctattgagtttcaattcagcacaggg
caaaaatttgaacttgtcgtgtatgattctgagcacaaagaaagataccgttattcgaaa
gaaaaaatgtttacgcaggcttttcaaaacctgacgcttgaatctggagaaacatatgat
ttctctgatgtgtggaaggaagtccctgagcccggaacctatgaggtaaaggtgacattt
aagggcagggcggaaaatctcaagcaggttcaggctgttcagcagtttgaagtcaaataa

DBGET integrated database retrieval system