KEGG   Bacillus subtilis subsp. subtilis 168: BSU11139
Entry
BSU11139          CDS       T00010                                 

Symbol
yizC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF3813
Other DBs
NCBI-GeneID: 8303093
NCBI-ProteinID: YP_003097702
UniProt: C0H3Y5 A0A6M3Z9X9
Position
complement(1190036..1190233)
AA seq 65 aa
MRNELFQQAKSFVQQAVMVTNGFEEGDQEQAILRAKNAVSSAYANSTDAERQQLHQFQNQ
LDKLQ
NT seq 198 nt   +upstreamnt  +downstreamnt
atgagaaatgaactgtttcagcaggcaaaatcatttgttcaacaggcggtcatggtgaca
aacggctttgaggaaggcgatcaggagcaagcgattctgagagccaaaaatgctgtatct
tctgcgtatgccaattcgacagatgcggaacgtcaacagttgcatcaatttcaaaatcag
ctggacaaactgcaataa

DBGET integrated database retrieval system