KEGG   Bacillus subtilis subsp. subtilis 168: BSU11140
Entry
BSU11140          CDS       T00010                                 

Gene name
yitU
Definition
(RefSeq) phosphatase YitU
  KO
K21064  5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase [EC:3.1.3.104]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00740  Riboflavin metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
Module
bsu_M00125  Riboflavin biosynthesis, plants and bacteria, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BSU11140 (yitU)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.104  5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase
     BSU11140 (yitU)
SSDB
Motif
Pfam: Hydrolase_3 S6PP HAD Hydrolase Trehalose_PPase Hydrolase_6
Other DBs
NCBI-GeneID: 939795
NCBI-ProteinID: NP_388995
Pasteur: BG12245
BSORF: BG12245
UniProt: P70947 A0A6M3Z9K6
Position
complement(1190490..1191302)
AA seq 270 aa
METKPYLIALDLDGTLLKDDKTISENTLHTIQRLKDDGHYVCISTGRPYRSSSMYYQQME
LTTPIVNFNGAFVHHPQDDSWGRYHTSLPLDVVKQLVDISESYNVHNVLAEVIDDVYFHY
HDEHLIDAFNMNTTNVTVGDLRENLGEDVTSVLIHAKEEDVPAIRSYLSDVHAEVIDHRR
WAAPWHVIEIIKSGMNKAVGLQKISDYYGVPRERIIAFGDEDNDLEMLEFAGCGVAMGNG
IDAVKQIANRTTATNEEDGVARFLKEYFSL
NT seq 813 nt   +upstreamnt  +downstreamnt
atggagacaaaaccctatttaatcgcattagatttagatggaacattattaaaggatgat
aaaaccatatctgaaaacacccttcatacgatacagcgcctaaaagatgacgggcattat
gtctgcatctcaacaggccgtccgtatcgttcaagttccatgtactaccagcagatggag
ctgacaacgccaattgtcaattttaacggagcatttgtccatcatccgcaagacgacagc
tggggacggtatcatacgtcactgccgcttgatgttgtcaaacagctcgtggatatcagc
gagagctacaacgtacataacgtgcttgctgaagtgattgacgacgtatactttcattac
catgatgagcacctgatagatgcctttaacatgaacacaacaaatgtaacggtcggagac
ttgcgggaaaatctcggtgaagatgtgacgtccgtactcatacatgcaaaggaagaggat
gtgccggcaatacgctcatatttatcggatgtgcatgccgaggtgatcgaccatagaaga
tgggccgctccttggcatgtcattgaaattatcaaaagcggcatgaataaagcggtcggc
ctgcagaaaatcagcgattattacggcgtgccgagggagcggatcattgcttttggagat
gaggataacgatttggaaatgcttgaatttgcaggctgcggcgttgcaatgggaaatgga
attgacgcggtcaagcagattgccaaccgaactacggccacaaatgaagaggacggcgtg
gcaaggtttttgaaagaatatttctcactttaa

DBGET integrated database retrieval system