KEGG   Bacillus subtilis subsp. subtilis 168: BSU11160
Entry
BSU11160          CDS       T00010                                 

Symbol
yitW
Name
(RefSeq) mip18 family protein YitW
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: FeS_assembly_P
Other DBs
NCBI-GeneID: 936378
NCBI-ProteinID: NP_388997
Pasteur: BG12247
BSORF: BG12247
UniProt: P70949 A0A6M4JHC0
Position
1192254..1192562
AA seq 102 aa
MEEALKENIMGALEQVVDPELGVDIVNLGLVYDVDMDEDGLTHITMTLTSMGCPLAPIIV
DEVKKALADLPEVKDTEVHIVWNPPWTRDKMSRYAKIALGIQ
NT seq 309 nt   +upstreamnt  +downstreamnt
gtggaagaagcattaaaagaaaacatcatgggcgccctggaacaggttgtcgatcctgag
cttggcgttgatatcgtgaacctcggcttggtatatgacgttgatatggatgaagatggc
ttgacgcacatcaccatgacgctaacatcaatgggatgccctttagcgccgattatcgtg
gatgaggtgaaaaaagcattagcggaccttcctgaagtgaaagacacagaggttcacatt
gtatggaatccgccttggactagggataaaatgtccagatacgcaaaaattgcgcttggc
attcaataa

DBGET integrated database retrieval system