KEGG   Bacillus subtilis subsp. subtilis 168: BSU11170
Entry
BSU11170          CDS       T00010                                 

Symbol
yitY
Name
(RefSeq) FAD-linked oxidoreductase YitY
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: FAD_binding_4 ALO DUF6794 FAD-oxidase_C
Other DBs
NCBI-GeneID: 939799
NCBI-ProteinID: NP_388999
Pasteur: BG12249
BSORF: BG12249
UniProt: Q796P5 A0A6M4JGU6
Position
1192858..1194288
AA seq 476 aa
MKKKLLAFALCTGAYAALFAYSVNSEQKTATSEMTDVSRLMPVKIKQTVKGQEEEMLIDT
VKEANRKNIKISIAGAQHSMGGHTYYEDGIVLDMTGYNKILSLDQEKKTIRVQSGATWND
IQKYVNPYGLAVKVMQSQNIFTIGGSLSANAHGRDIRYGSLIDTVKSFRLLKADGMIITV
TPKDDLFTAVIGGYGLFGVILDVTLELTDDELYVMKTEKMNYSTYSDYFSKHVKGNPDVR
MHLARISTAKKGFLKDMYVTNYVLANHQDQLSSYSELKEDEYTGATKFALGLSRRYEWGR
NWLWDTQQSYFLSQNGTEISRNNVMRSESKFLEYENNDNTDVLQEYFVPVKEYGSYIDDL
RQTLSDEDLNLLNITIRYVQKNEKADLSYAKDDMFSLVLLINEGFSKEDQADTARIIRRM
TDVAIKHGGSYYLPYMTYQTKAQMRQAYPKSEAFFQKKRTYDPDERFMNYFYQRYK
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgaaaaagaaattgcttgcattcgcgctttgtactggcgcgtatgcggccctgtttgcg
tactctgtgaactcagagcaaaaaacagccacaagcgagatgacggatgtcagccgcctg
atgcctgtaaaaataaagcagacagtgaaagggcaggaagaggaaatgctcattgacaca
gtcaaagaggcaaatcgaaaaaacataaaaatttcaatcgccggggcccagcactccatg
ggcggccatacatattatgaggacggcatcgttctcgacatgacgggctacaacaaaatc
ctgtcactcgatcaagagaagaaaaccatcagggtgcaaagcggtgcaacgtggaatgat
atccagaaatacgtgaatccatacggactcgcggtaaaagtcatgcagtcacaaaacatt
tttacaatcggcggatctctcagcgcaaatgcacacggacgtgatattcgctacggctcg
ctaattgatacagtcaaatcattccggcttttaaaagctgacgggatgattatcactgtc
actccaaaagatgatttgtttacggcggtcatcggagggtacggcctttttggcgtgatt
cttgatgtaacgcttgagctgacagatgatgagctgtatgtcatgaagacagaaaaaatg
aattacagcacatactcagactatttttcaaagcatgtaaaaggaaatccagatgtccga
atgcatctggcgcgaatttcaacagcgaaaaaaggatttctgaaagacatgtatgtcacg
aattacgtattggctaatcatcaggatcagctgtcctcatacagcgaacttaaagaagac
gagtatacgggagccacaaagtttgcactcggcttgtcaagacggtatgaatgggggagg
aattggctgtgggacacacagcaatcctatttcctgagccagaacggcacagagatttca
cgcaataacgtcatgcggtccgaatcaaagtttcttgagtatgaaaacaatgacaacaca
gatgttttgcaagaatactttgtgcccgtgaaggagtatgggtcctatattgatgacctg
agacaaacgctgtcggacgaagatctgaacctgctgaacattacgatccgctacgtgcag
aaaaatgaaaaggccgacctttcctatgcgaaggacgatatgttttcgctcgtactatta
ataaacgagggcttttcaaaagaagaccaggcagataccgcccgaatcatcaggcgcatg
acagacgttgccatcaagcacggcggcagctattatctgccttatatgacctaccagaca
aaagcgcaaatgagacaggcatatccgaaaagtgaagcgttttttcagaaaaaacgaacc
tatgacccggatgagcgctttatgaattacttttatcagaggtataaataa

DBGET integrated database retrieval system