KEGG   Bacillus subtilis subsp. subtilis 168: BSU11180
Entry
BSU11180          CDS       T00010                                 

Gene name
yitZ
Definition
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 939355
NCBI-ProteinID: NP_389000
Pasteur: BG12250
BSORF: BG12250
UniProt: P70952 A0A6M4JRB8
Position
1194333..1194827
AA seq 164 aa
MFFASSLIFPFYILFVKNIGSSYTQFGFSYGLFGLSGALIYPLLGRLSERFDSRYFLLLN
SWGMAVLLLYVPHIGSVVQVYIVQVLLGLFGAMQKHGEKVLIANFTDSGERGKKIGNYHF
WTAVFSAAAIMLGGFLADFFTVQMIFYASSILYFLSGLMMMKTG
NT seq 495 nt   +upstreamnt  +downstreamnt
gtgtttttcgcaagcagcttaatctttccgttttatattctgtttgtgaaaaatatcggc
tcaagctacacacagttcggtttttcctacggattgttcgggttgagcggagcgcttatt
tacccgctcctcggacggctgtctgaaaggtttgacagccgttattttctgcttctgaac
tcgtgggggatggctgttctgcttttatatgtcccgcatatcggaagcgtcgttcaagtg
tatatcgtccaagtgctgttagggctctttggagcgatgcaaaagcatggagaaaaagtg
ctgatcgctaattttacagacagtggagagcgtggaaagaagatcgggaattaccatttt
tggacagctgtcttttcagcagcagccattatgctcgggggctttctcgctgactttttc
acagtgcaaatgattttttatgcaagctctattctatattttttgagtggattgatgatg
atgaaaacaggctga

DBGET integrated database retrieval system