KEGG   Bacillus subtilis subsp. subtilis 168: BSU11190
Entry
BSU11190          CDS       T00010                                 

Symbol
argC
Name
(RefSeq) N-acetyl-gamma-glutamyl-phosphate reductase
  KO
K00145  N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00220  Arginine biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01210  2-Oxocarboxylic acid metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BSU11190 (argC)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.38  N-acetyl-gamma-glutamyl-phosphate reductase
     BSU11190 (argC)
SSDB
Motif
Pfam: Semialdhyde_dh Semialdhyde_dhC
Other DBs
NCBI-GeneID: 936389
NCBI-ProteinID: NP_389001
Pasteur: BG10191
BSORF: BG10191
UniProt: P23715 A0A6M3ZCV8
Position
1195034..1196071
AA seq 345 aa
MKIGIVGATGYGGTELVRILSHHPHAEECILYSSSGEGNVYSEGYPHLTGLADQQLKPID
MNTIKHEIDIMFLAAPPGVSSELTPKLADAGITVIDLSGDLRIKEPAEYEKWYKRTAAPK
AVIQEAVYGLAELNQLQIQQAKLIANPGCFPTAVLLGLAPLAQKKLLDESFVIVDAKTGV
SGAGRKASMGTHFSELNDNFKIYKVNEHQHTPEIEQALNEWQPGLGPITFSAHLVPMTRG
IMATMYTRLTCDLTADDLHDLYSEFYQDSYFVRVRPKGQYPQTKEVYGSNFCDIAVTLDE
RTNRVTIVSVIDNLMKGAAGQAVQNFNLMNGWNEETGLTITPIYP
NT seq 1038 nt   +upstreamnt  +downstreamnt
ttgaaaataggaattgtaggtgctacaggatatggaggcaccgaacttgtcaggattctt
tcgcatcatcctcatgcagaggaatgcatactttattcatccagcggagaagggaatgtc
tatagcgagggttatcctcatcttaccggcttagcggatcagcagctgaagccgattgat
atgaatacgatcaaacacgaaatagatatcatgtttctcgctgcgccgcccggagtatca
agtgaattgactccaaagctggcagacgcgggaattacggttattgatctgtcaggtgat
ctgaggataaaagaaccggctgaatatgaaaaatggtataaacggacagcggcaccgaag
gcggtgattcaagaggcggtatacggtctggcagaactgaatcaactgcaaattcaacag
gcgaaactcattgccaatccaggctgttttccaacagctgttttgcttggcctcgcgcca
ttggctcaaaagaaactgctcgatgaatctttcgttatcgttgacgcgaagaccggtgtt
tccggagcgggaagaaaagcatccatgggaactcatttttctgagctgaacgacaatttt
aaaatttataaagtcaatgaacatcagcacacgccggaaattgagcaggcgctgaatgaa
tggcagccaggtctcgggcccattacattttcggctcacttggttccgatgacaaggggc
atcatggcgacgatgtataccagattaacctgtgacctaaccgcagatgacctgcatgat
ttatattcggaattttaccaagattcatattttgtgagagtgaggccaaaaggtcagtac
ccgcaaacgaaagaagtgtacggcagcaatttctgtgatatcgccgtgaccctcgatgag
agaacgaacagagtcacgatcgtctcggtaatcgataatttaatgaagggtgccgccggt
caggcagtgcaaaactttaatttgatgaatggctggaatgaagaaactggactcaccatc
acgccaatttatccatag

DBGET integrated database retrieval system