KEGG   Bacillus subtilis subsp. subtilis 168: BSU11200
Entry
BSU11200          CDS       T00010                                 

Gene name
argJ
Definition
(RefSeq) arginine biosynthesis bifunctional protein ArgJ
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00220  Arginine biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01210  2-Oxocarboxylic acid metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BSU11200 (argJ)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     BSU11200 (argJ)
    2.3.1.35  glutamate N-acetyltransferase
     BSU11200 (argJ)
SSDB
Motif
Pfam: ArgJ
Other DBs
NCBI-GeneID: 939800
NCBI-ProteinID: NP_389002
Pasteur: BG10192
BSORF: BG10192
UniProt: P36843 A0A6M4JF64
Position
1196091..1197311
AA seq 406 aa
MIQLSEDQIVKVTGDVSSPKGFQAKGVHCGLRYSKKDLGVIISETPAVSAAVYTQSHFQA
APIKVTQDSLKHGPTLKAVIVNSAIANACTGEQGLKDAYTMRESFASQLGIEPELVAVSS
TGVIGEHLDMEKIHAGIELLKETPAGSGDFEEAILTTDTVIKQTCYELAIGGKTVTIGGA
AKGSGMIHPNMATMLGFVTTDAAIEEKALQKALREITDVSFNQITVDGETSTNDMVLVMA
NGCAENECLTEDHPDWPVFKKALLLTCEDLAKEIARDGEGATKLIEAQVQGAKNNLDANV
IAKKIVGSNLVKTAVYGTDANWGRIIGAIGHSAAQVTAEEVEVYLGGQCLFKNNEPQPFS
ESIAKEYLEGDEITIVIKMAEGDGNGRAWGCDLTYDYIKINASYRT
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgattcagttaagtgaagatcaaattgtaaaagtaacaggtgatgtatcctcgccaaaa
gggtttcaggcaaagggtgtgcattgcggactgcgctactcgaaaaaagacctcggcgtc
attatcagcgagacaccggccgtgagtgcagcagtttatacccaaagccactttcaggct
gctccgatcaaagtgacacaagacagcttaaagcacggaccgacactgaaagccgtcatc
gtcaacagcgccattgccaacgcctgcacgggagaacagggcttaaaggacgcatacaca
atgcgggagagctttgcttcacagcttggcattgagccggagcttgtcgctgtttcatca
acgggtgtcatcggcgagcatttagacatggaaaaaatccacgcggggatcgaactgctg
aaagaaacacctgcgggatcaggcgattttgaggaagcgattttaacaactgatacggtg
atcaagcagacgtgctatgaactggcaatcggcggcaaaacagtcacgatcggcggagcg
gccaaaggctctgggatgatacacccgaacatggccacgatgctgggatttgtgacaact
gacgcggcaatcgaagaaaaagcgctgcaaaaggcgcttcgggaaatcactgacgtttca
tttaaccaaatcacagttgacggagaaacatccacgaacgacatggtattagttatggcg
aatggctgcgccgaaaacgagtgcctgacagaagaccatccagactggccggtctttaaa
aaagcgctcttgctcacttgtgaggatctagctaaagagattgccagagacggagaaggc
gcgacaaaactaattgaagcccaagtacagggagcgaaaaacaatcttgatgcaaacgtc
attgccaaaaagattgtcggctcaaatcttgtaaaaacggcagtatacggaacagatgcc
aactgggggcggatcatcggagccatcggacactccgcagcacaggtgacggcagaagaa
gtagaggtttatcttggcggccaatgcctgtttaagaataacgaacctcagccattctct
gaatctatcgccaaggaataccttgaaggagatgaaatcaccattgtcatcaagatggct
gaaggggacggaaacgggagagcgtggggctgtgacctgacctatgactatatcaaaatt
aacgcgagctatcgcacgtaa

DBGET integrated database retrieval system