KEGG   Bacillus subtilis subsp. subtilis 168: BSU11210
Entry
BSU11210          CDS       T00010                                 

Gene name
argB
Definition
(RefSeq) acetylglutamate kinase
  KO
K00930  acetylglutamate kinase [EC:2.7.2.8]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00220  Arginine biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01210  2-Oxocarboxylic acid metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BSU11210 (argB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.8  acetylglutamate kinase
     BSU11210 (argB)
SSDB
Motif
Pfam: AA_kinase Flot
Other DBs
NCBI-GeneID: 936381
NCBI-ProteinID: NP_389003
Pasteur: BG10193
BSORF: BG10193
UniProt: P68729 A0A6M3ZEN5
Position
1197326..1198102
AA seq 258 aa
MKKTIVFKCGGSVIRELSEEFYQNLKELRASGWKLAIVHGGGPEITNMLKRLNIKTEFSG
GQRKTTKPVLEVAEMVLSGSVNKFFVAELAKHGLRAAGISGKDGGLLEADYLDPETYGEV
GEIKKVDASMVNALMENGIIPVIAPLSMTSDCKTLNVNADLAASAVAGALEADKLMFVTD
VDGIMKEKQRLDVLTPKEIQMLIKQEVITGGMIPKVNSALSALSDQVSEVMIVNGKGSFF
AEQTFQGTKIVKAKEAVS
NT seq 777 nt   +upstreamnt  +downstreamnt
atgaagaaaacaatcgtttttaaatgcgggggaagcgtcatccgtgagctgtcggaggaa
ttttatcaaaatctgaaagagctgagggcgtcaggctggaagctggcaatcgtacatggc
gggggaccggaaatcacaaatatgctgaaacggttaaatatcaagacagagttttcgggc
ggacagaggaaaacaacgaagccggtgctggaagtggcggaaatggttttatccggttct
gtcaataaatttttcgttgctgagcttgccaaacacggactgcgagccgcgggcatttct
ggtaaggatggcggtcttttggaggctgattatctagatccggaaacatacggagaagtg
ggagaaatcaaaaaagtcgatgcgtccatggtgaacgcgctgatggaaaatggcatcatc
cccgttattgcgccgctgtctatgacaagcgactgcaaaacgctgaatgtaaatgctgat
ctggctgcttcagcagtcgccggagcgcttgaagccgataagctgatgttcgtcacggat
gtcgatggaatcatgaaggaaaagcagcgtctggacgtcctgacccctaaggagattcag
atgctgatcaagcaggaagtgatcacaggagggatgatcccgaaggtcaattcagccttg
tcagctttatcagatcaggtgtctgaagtcatgatcgtaaacggtaaaggatcattcttc
gcagaacaaacctttcaagggacaaaaattgtcaaagcaaaggaggctgtttcatga

DBGET integrated database retrieval system