KEGG   Bacillus subtilis subsp. subtilis 168: BSU11220
Entry
BSU11220          CDS       T00010                                 

Gene name
argD
Definition
(RefSeq) acetylornithine aminotransferase
  KO
K00821  acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00220  Arginine biosynthesis
bsu00300  Lysine biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01210  2-Oxocarboxylic acid metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    BSU11220 (argD)
   00220 Arginine biosynthesis
    BSU11220 (argD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU11220 (argD)
Enzymes [BR:bsu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.11  acetylornithine transaminase
     BSU11220 (argD)
    2.6.1.17  succinyldiaminopimelate transaminase
     BSU11220 (argD)
Amino acid related enzymes [BR:bsu01007]
 Aminotransferase (transaminase)
  Class III
   BSU11220 (argD)
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2
Other DBs
NCBI-GeneID: 939357
NCBI-ProteinID: NP_389004
Pasteur: BG10194
BSORF: BG10194
UniProt: P36839 A0A6M4JKE8
Position
1198099..1199256
AA seq 385 aa
MSSLFQTYGRWDIDIKKAKGTYVEDQNGKTYLDFIQGIAVSNLGHCHEAVTEAVKKQLDS
VWHVSNLFQNSLQEQAAQKLAAHSAGDLVFFCNSGAEANEGAIKLARKATGKTKIITFLQ
SFHGRTYAGMAATGQDKIKTGFGPMLGGFHYLPYNDPSAFKALGEEGDIAAVMLETVQGE
GGVNPASAEFLSAVQSFCKEKQALLIIDEIQTGIGRTGKGFAYEHFGLSPDIITVAKGLG
NGFPVGAVIGKKQLGEAFTPGSHGTTFGGNMLAMAAVNATLQIVFQPDFLQEAADKGAFL
KEQLEAELKSPFVKQIRGKGLMLGIECDGPVADIIAELQTLGLLVLPAGPNVIRLLPPLT
VTKDEIAEAVSKLKQAIAHHSAVNQ
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgagcagcttgtttcaaacctacggccgttgggatattgacatcaaaaaagcaaaggga
acgtacgttgaggatcaaaacggcaaaacgtaccttgatttcattcaggggattgcggta
tcaaatctaggacactgccatgaagcggtgacagaggcagtcaaaaaacagcttgacagc
gtatggcacgtatccaacctgtttcaaaacagtctccaagagcaagcggcgcagaagctg
gcagcgcatagtgcgggagatcttgtctttttctgcaacagcggcgcggaggcgaatgaa
ggtgcgataaagcttgccagaaaagcaactggaaaaacaaaaatcatcacttttcttcag
tcgttccatggccgcacgtatgcagggatggctgcgaccggacaggataaaatcaaaaca
ggcttcggcccgatgcttggaggctttcactacctgccatacaatgatccttctgctttt
aaagctcttggggaggaaggcgatattgccgcggtgatgcttgaaacagtgcagggagaa
ggaggagtcaatccggcgagtgctgaatttttatcagccgtacagtcgttttgcaaggaa
aagcaagcccttctcattattgatgaaatccagaccggcatcggacggacgggaaaaggc
ttcgcatatgagcacttcggactctcaccggatatcatcacagtcgccaaaggattggga
aacggctttccggtcggcgctgtcatcggaaagaaacagcttggagaagcgtttacccct
ggttctcacggaacgactttcggaggaaacatgctggcgatggctgctgtgaatgccaca
ttgcaaattgtattccagcctgactttttgcaagaggctgctgacaaaggggcgttttta
aaagaacagcttgaggcagagctaaagagcccttttgttaaacaaatccgaggtaaagga
ttaatgcttggaattgagtgtgatggcccggttgctgacattattgctgaattgcagaca
ttaggcttgcttgtattgccggccggcccgaacgtgattcggctgctgccgccgctcacc
gtgactaaggatgaaatagcagaagccgtcagcaagctgaaacaggcaatcgctcatcat
tccgctgtaaaccagtga

DBGET integrated database retrieval system