KEGG   Bacillus subtilis subsp. subtilis 168: BSU11230
Entry
BSU11230          CDS       T00010                                 

Gene name
carA
Definition
(RefSeq) carbamoyl-phosphate synthase arginine-specific small chain
  KO
K01956  carbamoyl-phosphate synthase small subunit [EC:6.3.5.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00240  Pyrimidine metabolism
bsu00250  Alanine, aspartate and glutamate metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BSU11230 (carA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSU11230 (carA)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     BSU11230 (carA)
SSDB
Motif
Pfam: CPSase_sm_chain GATase Peptidase_C26
Other DBs
NCBI-GeneID: 936387
NCBI-ProteinID: NP_389005
Pasteur: BG10195
BSORF: BG10195
UniProt: P36838 A0A6M3Z9S5
Position
1199327..1200388
AA seq 353 aa
MEGYLVLEDGTSFSGELDGHENCTGEAVFFTGMTGYQEVLTDPSYKGQIIVFTYPLIGNY
GINEKDFESKKPQVKAAVVYEACDHFSHYEAVYSLKEYLQKWNIPLLTHVDTRAVVKKIR
ANGTMGATVTASKEGAEIALQPENVAEQASAQEISTFGDGNKHIALIDFGYKKSIASSLV
KRGCKVTVVPYQQMEAVYNIKPDGIVLSNGPGDPKAIQPYLGKIKSIISRFPTLGICLGH
QLIALAFGGNTFKLPFGHRGANHPVIDRKTKRVFMTSQNHSYVVDEQSINEEELTIRFHH
VNDTSVEGLAHKKLPVMSVQFHPEAHPGPAESEWIFDDYLKNVIPARREIAHA
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggaaggttatttagtgttagaagatgggacatcgttcagcggcgagctggacggtcat
gaaaactgcacgggagaagctgtttttttcacaggaatgacaggctaccaggaagtgctg
acagatccatcatataagggacagattattgtatttacctacccgctgattggcaactac
ggcataaatgaaaaggattttgaaagcaagaaaccgcaagtaaaagccgcggttgtctat
gaggcgtgtgatcacttttctcattatgaagcggtatacagcctcaaggagtatctacag
aaatggaatattccgctgttaacccatgttgatacgagggctgtcgtgaagaaaatccgg
gcaaacgggacgatgggtgcgacagtcacagcctctaaagaaggagctgagattgccctt
caaccagagaatgtggcagagcaggcttccgcccaggaaatcagcacattcggcgacggg
aataaacatatcgctctcattgattttggctataaaaagtcaatcgcatcatcacttgtc
aaacgaggctgcaaggttaccgtggtgccataccagcaaatggaggccgtatacaacatc
aaacccgatggaattgtgctatcgaacggacctggagatccgaaagccattcagccatat
ttaggaaagatcaaaagcatcatcagccgctttccgactctaggcatttgtctcggacat
cagctgatcgcgctcgcgtttggagggaatacttttaagctgccattcgggcacagggga
gctaatcatccggtcatcgaccgtaagacgaaacgggtctttatgacaagccaaaaccac
agctatgtggttgatgaacagtcgattaatgaagaagagctcaccatcaggtttcatcat
gtcaatgatacgtcagttgaagggcttgcccataaaaaactgcctgtcatgagtgttcaa
ttccacccggaagcccatcccggacctgcggaaagcgaatggatttttgatgattatcta
aagaatgtgataccagcaaggagagaaatcgcgcatgcctaa

DBGET integrated database retrieval system