KEGG   Bacillus subtilis subsp. subtilis 168: BSU11240
Entry
BSU11240          CDS       T00010                                 

Gene name
carB
Definition
(RefSeq) carbamoyl-phosphate synthase arginine-specific large chain
  KO
K01955  carbamoyl-phosphate synthase large subunit [EC:6.3.5.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00240  Pyrimidine metabolism
bsu00250  Alanine, aspartate and glutamate metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BSU11240 (carB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSU11240 (carB)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     BSU11240 (carB)
SSDB
Motif
Pfam: CPSase_L_D2 CPSase_L_D3 ATP-grasp Dala_Dala_lig_C ATP-grasp_3 ATPgrasp_Ter GARS_A ATP-grasp_4 ATP-grasp_5 STAS Hydrolase_3
Other DBs
NCBI-GeneID: 939353
NCBI-ProteinID: NP_389006
Pasteur: BG10196
BSORF: BG10196
UniProt: P18185 A0A6M3Z9L3
Position
1200381..1203473
AA seq 1030 aa
MPKDTSISSILVIGSGPIIIGQAAEFDYSGTQGCIALKEEGYRVILVNSNPATIMTDEAF
ADEIYFEPLTAESLTAIIKKERPDGLLANLGGQTALNLAVELEETGVLKEHGVKLLGTSV
ETIQKGEDREKFRSLMNELKQPVPESEIVDNEADALHFAESIGFPVIIRPAYTLGGKGGG
IAPDKEAFTAMIKQALLASPINQCLVEKSIAGFKEIEYEVMRDSNNTCITVCNMENIDPV
GVHTGDSIVVAPSQTLTDEDYQMLRTASLTIISALDVVGGCNIQFALDPFSKQYYVIEVN
PRVSRSSALASKATGYPIAKMAAKLAVGYTLDELKNPLTGSTYASFEPALDYVIVKFPRW
PFDKFKNADRKLGTKMKATGEVMAIERNLEAAIQKAAASLELKNIGTHLPELSGLSIDTL
WDLAITPDDRRFFVVMELLSRSVSIDDIHEKTKIDPFFLHTFDNIIKLENRLMEAGSDLS
FELLKKAKEKGFSDATIASLISKTEEEVRALRKEMGITPSFKIVDTCAAEFDAKTNYFYS
TYFGETDGDISRKEKKRALIIGSGPIRIGQGVEFDYSAVHGVLTLQELGFETIMINNNPE
TVSTDYEIADRLYFEPMTTEHIVNVAEQENIDFAIVQFGGQTAINAAEALEKAGITLLGT
SFQTLDVLEDRDQFYQLLDELGLKHAKGEIAYTKEEAASKASEIGYPVLIRPSYVIGGMG
MIIVDSQAQLSQLLNDEDSMPYPILIDQYVSGKEVEIDLISDGEEVFIPTYTEHIERAGV
HSGDSFAILPGPSITSGLQQGMKDAAQKIARKLSFKGIMNIQFVIDNGNILVLEVNPRAS
RTVPVVSKVMGVPMIPLATRLLAGASLKDLNPAVQNHHGVAVKFPVFSSHAIQDVDVKLG
PEMKSTGEGMCVAYDSNSALKKIYTRVWSQKGSIYLQNVPEDVKELAENAGFTIHEGTFA
SWMEQEGNSLHINLSGSEEARKERLEAMTHGIPVFTEEETVRAFLQSGSGHPQPVSLKDL
YKKEVASCTQ
NT seq 3093 nt   +upstreamnt  +downstreamnt
atgcctaaagacaccagtatttcaagcatattagtaattggctcaggcccgatcatcatc
gggcaggcggcagaatttgattattcaggcactcaagggtgcatcgcgctgaaggaggag
ggctaccgggtaattctcgtcaacagcaatccggcgacaattatgactgatgaagccttc
gctgatgaaatttattttgagcctctgacagcagaaagcctgacagccatcattaagaaa
gaacggcctgatgggcttcttgccaatttaggcggtcagaccgcgttgaatttagcggtg
gagcttgaagaaacgggtgttttaaaagagcacggcgtcaaactcctcggcacatccgtt
gaaacgatacaaaaaggagaggaccgggaaaaattccgttcgttaatgaatgaattaaaa
cagcctgtgccggagagtgaaattgttgataacgaggccgatgccctccattttgcggaa
tccatcggttttcctgttattatcagaccagcttacacattaggcggaaagggcggagga
atcgcccctgataaagaagcctttacagctatgattaagcaggcgctattagcaagcccg
atcaatcaatgccttgtcgaaaaaagcattgccggctttaaagaaattgaatatgaagtc
atgcgtgacagcaataacacatgcattaccgtctgcaatatggaaaatatcgatccggtc
ggcgtgcatacaggtgactctatcgttgtggcgccgtcacaaacattgacagacgaagac
tatcaaatgctgcggacagcaagtctgacgatcatctcagcacttgatgttgtaggcggc
tgcaacattcaattcgcgcttgatccattcagcaagcaatattacgtcattgaagtgaat
ccgcgtgtaagccggtcatcggctctcgcatctaaagcgaccggttatccgattgcgaag
atggccgcgaaactggcagtcggatacactcttgacgagctgaaaaatccgctcacaggc
tcgacttacgcaagctttgaaccggcactggattatgtgatcgtcaaatttccgcgctgg
ccgtttgataaattcaaaaacgcagaccgcaagcttggcacaaaaatgaaagccaccggt
gaagtgatggcgattgaacggaatttagaagcggcgatacaaaaggcagccgcgtcgctt
gaattaaaaaatatcgggacacaccttccagagctcagcgggttgtcaattgatacgcta
tgggatttggcaatcactccggatgaccgcagatttttcgttgtcatggagctgttgagc
cgcagcgtctcgattgatgacatccatgaaaaaacaaaaattgatccgtttttccttcat
acctttgacaacatcatcaaattggaaaaccgcctgatggaagcagggagcgatctctct
tttgaattattgaagaaagcaaaggaaaagggattctcagacgcaacgattgcctcgctg
atcagcaaaacagaagaagaggtgcgcgcgcttcgcaaggagatgggcattacgccttcc
tttaaaatcgtagatacatgcgcggcagagtttgatgcgaaaacaaactatttttactcc
acatatttcggagagaccgatggagacatcagccgcaaagagaaaaaacgcgcgctcatt
atcggatcaggcccgattcggatcggccaaggcgttgaatttgattacagtgctgttcac
ggtgtgctgacactgcaagagcttgggttcgaaaccatcatgattaacaataacccggaa
actgtcagcaccgattatgaaattgcggaccgcctgtattttgaaccgatgacaacggag
catattgtaaacgtggcggagcaggaaaatattgattttgcaattgtgcaatttggcggt
caaactgcaatcaatgctgctgaagcgctcgaaaaagccggcattactcttcttggcaca
tcatttcaaacgctcgacgtgttagaggatcgggatcaattttatcagcttcttgacgag
ctgggattgaagcacgcaaaaggagaaattgcttatacaaaagaagaagccgcttcaaaa
gcgagtgagatcggctatccggtgttaatccgcccatcttacgttatcggcggaatgggc
atgatcattgttgactcgcaagcccagctttctcagctgctgaatgatgaggacagcatg
ccatacccgattttaattgatcagtatgtgtctggaaaggaagtcgaaattgatttgatt
tccgacggcgaggaagtctttatcccgacatataccgagcatattgaacgggcaggtgtc
cattcaggggacagttttgccattcttcccggaccgtccatcacgagcgggctgcagcag
ggcatgaaagatgcggcacaaaaaattgcccgaaaactttcatttaaaggcatcatgaac
attcaatttgtgatcgacaatggaaacatactcgttcttgaagtgaatccgagagcgagc
cgcacggttcctgtcgtcagcaaagtaatgggcgttccgatgattccgctcgccacacgt
ctgctggcgggagcgtccttaaaagatctaaatccggcagttcaaaatcatcatggagtt
gccgtgaagttccctgttttttcttctcatgcgatccaggatgtggatgtcaagcttgga
ccggaaatgaaatcaacgggagaaggcatgtgtgtcgcatatgattctaacagcgccttg
aaaaaaatctatacaagagtctggagtcaaaaaggaagcatttatttgcaaaacgttccg
gaagatgtgaaggagttagcagaaaacgcaggttttacaatacatgaaggaacatttgcc
tcatggatggaacaggaaggaaactcgctccacattaatctgagcggttctgaagaagca
cgcaaagaacgtttggaagccatgacgcacggcatccccgtctttacagaagaagaaact
gtgcgggcgtttttacaaagcggttcaggccatccgcagcctgtatctctcaaagacctc
tataaaaaggaagtggcatcatgcacacagtga

DBGET integrated database retrieval system