KEGG   Bacillus subtilis subsp. subtilis 168: BSU11260
Entry
BSU11260          CDS       T00010                                 

Gene name
yjzC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YjzC
Other DBs
NCBI-GeneID: 936385
NCBI-ProteinID: NP_389008
Pasteur: BG13223
BSORF: BG13223
UniProt: O34585 A0A6M4JRI6
Position
1204506..1204685
AA seq 59 aa
MGQQHQFRPGQKAPNNGVYVEIGETGSMVKNPQKVHLSAGEMFPETSNHNRLWTYKRKP
NT seq 180 nt   +upstreamnt  +downstreamnt
gtgggacagcagcaccaattccggcccggacagaaagcgcctaataacggtgtctacgta
gaaatcggcgagacagggagcatggttaaaaaccctcaaaaggtccatctgtcagcaggg
gaaatgttccccgaaacatcaaaccacaaccggctgtggacctacaaaagaaagccgtga

DBGET integrated database retrieval system