KEGG   Bacillus subtilis subsp. subtilis 168: BSU11270
Entry
BSU11270          CDS       T00010                                 

Gene name
yjzD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2929 DUF4153
Other DBs
NCBI-GeneID: 939364
NCBI-ProteinID: NP_389009
Pasteur: BG13224
BSORF: BG13224
UniProt: O34713 A0A6M3Z9E4
Position
complement(1204731..1204916)
AA seq 61 aa
MRYIIAFIWTFLLSHMACYLVASMNSVTYNFKTSSVIAVVLYVLIMVLAEIMPMNKNASQ
H
NT seq 186 nt   +upstreamnt  +downstreamnt
gtgcgatatattattgcctttatttggacgttccttttatcacatatggcatgctacttg
gttgcaagcatgaacagcgttacgtataatttcaaaacatcatctgtcattgctgttgta
ctgtatgtcttaatcatggttttagcagaaatcatgcctatgaacaaaaatgcaagccag
cattaa

DBGET integrated database retrieval system