KEGG   Bacillus subtilis subsp. subtilis 168: BSU11280
Entry
BSU11280          CDS       T00010                                 

Gene name
yjaU
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Hydrolase_4
Other DBs
NCBI-GeneID: 936395
NCBI-ProteinID: NP_389010
Pasteur: BG13124
BSORF: BG13124
UniProt: O35001 A0A6M3Z9B9
Position
1205165..1205899
AA seq 244 aa
MGITERYFQLGTEHNVIHLPYRPNGFGIFILGDRTHFVGHDSSFWQQHYGRNQLLSMLMN
EGYTLFNSNLFGRHWGAEKAVTYAKQLIHSVLKQEILNPKIHILAEGMGALVADELLRFS
PDHIRSAAMLNPCLDLQAHYESEKENKFFYKQFLKEVSKSYGISEKEAEAIRYKTIQSYP
SGVPVHIWQRMTGAPYPYSVHAEVFKEKQQKQGSPVDMTFHLFEHPSRIYASICKFFHSH
EKEL
NT seq 735 nt   +upstreamnt  +downstreamnt
atgggaataacggaaagatactttcaactgggaacggagcataatgtcattcatctgccc
tatcgcccgaacggcttcggcatctttatcttgggggacagaacccactttgtcggacat
gattcaagcttttggcagcagcattatggcagaaatcagcttctgagcatgttgatgaat
gaaggatacactctttttaacagcaatctgttcggaaggcattggggggcggaaaaagca
gtcacctatgccaaacagctgatacattctgtgctgaagcaggaaatcctcaatccgaag
attcatattttagcagaaggcatgggtgctctcgtggccgatgaactgcttcgtttttcc
ccggatcatatccgctcagccgcaatgttgaatccttgtctcgatcttcaggcacattat
gaatcggaaaaagaaaataaatttttctataagcaatttttgaaagaagtatcgaaaagc
tacggaatttctgaaaaagaagcggaagcgattcgttataaaacaattcaaagctacccg
agcggcgtaccggttcatatatggcagcgtatgaccggagctccatatccctacagcgta
catgcggaagttttcaaggaaaaacagcaaaagcaaggctcaccggtcgacatgacattt
catttatttgagcatccaagcagaatttatgcatcaatttgcaaattctttcatagtcat
gaaaaagaattatag

DBGET integrated database retrieval system