KEGG   Bacillus subtilis subsp. subtilis 168: BSU11290
Entry
BSU11290          CDS       T00010                                 

Gene name
yjaV
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: adh_short
Other DBs
NCBI-GeneID: 939802
NCBI-ProteinID: NP_389011
Pasteur: BG13125
BSORF: BG13125
UniProt: O34959 A0A6M4JGV5
Position
1205981..1206538
AA seq 185 aa
MESTLIVGADEFFGLSLCERMMDEGIHVDVVLAETEDKMRQMYLEERLMWLGRNELFRQL
EHIGDQNYDTICIQFGSFLPLDQYDSPYILVYEEDRKEWDKREKTGSEKTVILPKMYGPW
KEETEEDGYYTNDVADELLRFLLEPSRHSKDQLFELQVTEKTSKEEAKTKIIEWKRQFSS
IFDKY
NT seq 558 nt   +upstreamnt  +downstreamnt
atggaatcaacgctgattgtaggtgcggacgaatttttcggcctttcattatgtgagcga
atgatggatgaaggcatacatgttgacgttgttctggcggaaacagaagataaaatgaga
caaatgtacttagaagaaagactcatgtggcttgggagaaatgaactctttcgccagctt
gaacacattggagaccaaaattatgatacaatttgtatccagttcggaagttttttgcct
ttagaccaatatgattctccttatattttagtatatgaagaagaccgaaaagaatgggat
aaacgtgaaaaaacaggctcggaaaaaaccgtgatcctgccgaaaatgtacgggccatgg
aaagaagaaacagaggaagacggctattacacaaacgacgtggctgacgagttgctgaga
ttcctgttagaaccaagccgtcatagcaaagatcagctttttgaattgcaagtcacagag
aaaacctcaaaagaagaagcaaaaacaaaaattatcgagtggaaaagacaattttcatca
attttcgacaaatattaa

DBGET integrated database retrieval system