KEGG   Bacillus subtilis subsp. subtilis 168: BSU11310Help
Entry
BSU11310          CDS       T00010                                 

Gene name
comZ
Definition
(RefSeq) ComG operon repressor
  KO
K02254  competence protein ComZ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU11310 (comZ)
Secretion system [BR:bsu02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) related proteins
   BSU11310 (comZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComZ RabGAP-TBC
Motif
Other DBs
NCBI-GeneID: 939358
NCBI-ProteinID: NP_389013
Pasteur: BG13221
BSORF: BG13221
UniProt: O32437
Position
1207597..1207788
Genome map
AA seq 63 aa AA seqDB search
MQHEKSLEFLQIAMKYLPEAKEQLEKSGIELSMEAIQPFMNLFTTVMAEAYELGKSDAKS
ETE
NT seq 192 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacgaaaaatcacttgaattcttgcaaattgccatgaaatatctccctgaagcg
aaagaacagcttgagaaatcaggcattgagctctcaatggaggccatccagccgtttatg
aatctatttacaacggtaatggcggaagcttatgagcttggcaagtctgacgctaaatct
gaaacagaataa

DBGET integrated database retrieval system