KEGG   Bacillus subtilis subsp. subtilis 168: BSU11320
Entry
BSU11320          CDS       T00010                                 

Gene name
yjzB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HrpJ VPS28 BLOC1_2 YppG Bindin
Other DBs
NCBI-GeneID: 939366
NCBI-ProteinID: NP_389014
Pasteur: BG13222
BSORF: BG13222
UniProt: O34891 A0A6M4JLZ4
Position
complement(1207818..1208057)
AA seq 79 aa
MQLDVFSRMMFGDAAKPTEEKEEEQQEEVSQVSQTNDEETINYMHIMDQIGSIMNSLDQI
KPALKELAPMLSAIKKKIM
NT seq 240 nt   +upstreamnt  +downstreamnt
atgcagttggatgtgttttcaagaatgatgttcggcgatgcagcaaaaccaacagaagag
aaggaggaggaacagcaagaggaagtttctcaggtttctcagacaaacgacgaagagacg
attaattacatgcatattatggaccaaatcggttcaattatgaactctcttgatcaaatc
aagcccgctttaaaggagcttgcgcccatgctctccgctattaaaaagaaaatcatgtga

DBGET integrated database retrieval system