KEGG   Bacillus subtilis subsp. subtilis 168: BSU11330Help
Entry
BSU11330          CDS       T00010                                 

Gene name
fabHA
Definition
(RefSeq) 3-oxoacyl-ACP synthase III
  KO
K00648  3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00061  Fatty acid biosynthesis
bsu01100  Metabolic pathways
bsu01212  Fatty acid metabolism
Module
bsu_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BSU11330 (fabHA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bsu01004]
    BSU11330 (fabHA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.180  beta-ketoacyl-[acyl-carrier-protein] synthase III
     BSU11330 (fabHA)
Lipid biosynthesis proteins [BR:bsu01004]
 Fatty acid synthase
  Component type
   BSU11330 (fabHA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACP_syn_III_C ACP_syn_III Thiolase_N Chal_sti_synt_C SpoVAD Chal_sti_synt_N HMG_CoA_synt_N
Motif
Other DBs
NCBI-GeneID: 936392
NCBI-ProteinID: NP_389015
Pasteur: BG13127
BSORF: BG13127
UniProt: O34746
Position
1208222..1209160
Genome map
AA seq 312 aa AA seqDB search
MKAGILGVGRYIPEKVLTNHDLEKMVETSDEWIRTRTGIEERRIAADDVFSSHMAVAAAK
NALEQAEVAAEDLDMILVATVTPDQSFPTVSCMIQEQLGAKKACAMDISAACAGFMYGVV
TGKQFIESGTYKHVLVVGVEKLSSITDWEDRNTAVLFGDGAGAAVVGPVSDDRGILSFEL
GADGTGGQHLYLNEKRHTIMNGREVFKFAVRQMGESCVNVIEKAGLSKEDVDFLIPHQAN
IRIMEAARERLELPVEKMSKTVHKYGNTSAASIPISLVEELEAGKIKDGDVVVMVGFGGG
LTWGAIAIRWGR
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctggaatacttggtgttggacgttacattcctgagaaggttttaacaaatcat
gatcttgaaaaaatggttgaaacttctgacgagtggattcgtacaagaacaggaatagaa
gaaagaagaatcgcagcagatgatgtgttttcatcacatatggctgttgcagcagcgaaa
aatgcgctggaacaagctgaagtggctgctgaggatctggatatgatcttggttgcaact
gttacacctgatcagtcattccctacggtctcttgtatgattcaagaacaactcggcgcg
aagaaagcgtgtgctatggatatcagcgcggcttgtgcgggcttcatgtacggggttgta
accggtaaacaatttattgaatccggaacctacaagcatgttctagttgttggtgtagag
aagctctcaagcattaccgactgggaagaccgcaatacagccgttctgtttggagacgga
gcaggcgctgcggtagtcgggccagtcagtgatgacagaggaatcctttcatttgaacta
ggagccgacggcacaggcggtcagcacttgtatctgaatgaaaaacgacatacaatcatg
aatggacgagaagttttcaaatttgcagtccgccaaatgggagaatcatgcgtaaatgtc
attgaaaaagccggactttcaaaagaggatgtcgactttttgattccgcatcaggcgaac
atccgtatcatggaagctgctcgcgagcgtttagagcttcctgtcgaaaagatgtctaaa
actgttcataaatatggaaatacttctgccgcatccattccgatctctcttgtagaagaa
ttggaagccggtaaaatcaaagacggcgatgtggtcgttatggtagggttcggcggagga
ctaacatggggcgccattgcaatccgctggggccgataa

DBGET integrated database retrieval system