KEGG   Bacillus subtilis subsp. subtilis 168: BSU11340Help
Entry
BSU11340          CDS       T00010                                 

Gene name
fabF
Definition
(RefSeq) 3-oxoacyl-[acyl-carrier-protein] synthase 2
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00061  Fatty acid biosynthesis
bsu00780  Biotin metabolism
bsu01100  Metabolic pathways
bsu01212  Fatty acid metabolism
Module
bsu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BSU11340 (fabF)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BSU11340 (fabF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bsu01004]
    BSU11340 (fabF)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     BSU11340 (fabF)
Lipid biosynthesis proteins [BR:bsu01004]
 Fatty acid synthase
  Component type
   BSU11340 (fabF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N
Motif
Other DBs
NCBI-GeneID: 939803
NCBI-ProteinID: NP_389016
Pasteur: BG13128
BSORF: BG13128
UniProt: O34340
Structure
PDB: 

Position
1209183..1210424
Genome map
AA seq 413 aa AA seqDB search
MTKKRVVVTGLGALSPLGNDVDTSWNNAINGVSGIGPITRVDAEEYPAKVAAELKDFNVE
DYMDKKEARKMDRFTQYAVVAAKMAVEDADLNITDEIAPRVGVWVGSGIGGLETLESQFE
IFLTKGPRRVSPFFVPMMIPDMATGQISIALGAKGVNSCTVTACATGTNSIGDAFKVIQR
GDADVMVTGGTEAPLTRMSFAGFSANKALSTNPDPKTASRPFDKNRDGFVMGEGAGIIVL
EELEHALARGAKIYGEIVGYGSTGDAYHITAPAQDGEGGARAMQEAIKDAGIAPEEIDYI
NAHGTSTYYNDKYETMAIKTVFGEHAHKLAVSSTKSMTGHLLGAAGGIEAIFSILAIKEG
VIPPTINIQTPDEECDLDYVPDEARRQELNYVLSNSLGFGGHNATLIFKKYQS
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaaagagtagttgttacaggacttggagcattatctccacttggcaacgac
gtcgatacaagttggaataacgcaatcaacggtgtgtccggaatcggtccgatcactcgt
gttgacgctgaagaatatccggcaaaagttgccgctgaattaaaagattttaatgttgaa
gattatatggataaaaaagaagccagaaaaatggaccgctttacacaatatgcggttgtg
gctgcgaaaatggcggttgaagatgcagatcttaacattaccgatgagatcgcgccgaga
gtcggtgtttgggtaggctccggtatcggaggacttgaaacactagagtctcaatttgaa
atcttcttaacaaaaggcccaagacgggtaagcccgtttttcgtgccaatgatgattcct
gacatggcgacaggccagatttctattgcattaggagcaaaaggggtgaactcttgtacg
gttacagcatgtgctacaggaacgaactccatcggtgacgcgtttaaggttattcagcgc
ggtgatgcagacgtgatggtcacaggcggaacagaagcgccgctgacaagaatgtcattc
gccggctttagtgccaacaaagcgctgtctactaatccagatccgaaaacagcgagccgc
ccgtttgataaaaaccgtgatggctttgtcatgggggaaggtgcagggattatcgttctt
gaagaacttgagcatgccctggcccgcggcgctaaaatttacggagaaattgtcggctac
ggctcaaccggagacgcttatcatatcacagcgccggcccaagacggtgaaggcggagcg
agagcgatgcaagaagccattaaagatgcaggcattgcacctgaagaaattgattacatc
aatgctcacgggacaagcacgtattacaacgacaaatacgaaacaatggcgattaagacc
gtttttggcgagcatgcgcataaacttgcggtaagctctacaaaatcgatgacaggccac
ctcttaggagcagccggcggtattgaagccattttctctatcctggccattaaagaaggc
gtgattccgccgacaatcaatattcaaacacctgacgaagaatgtgatttggattatgtg
cctgatgaagcccgcagacaggaacttaattatgttctcagcaactcattaggattcggc
ggacacaacgcaacattaatctttaaaaaatatcaatcataa

DBGET integrated database retrieval system