KEGG   Bacillus subtilis subsp. subtilis 168: BSU11350
Entry
BSU11350          CDS       T00010                                 

Gene name
yjaZ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2268 DUF5700 Pkinase
Other DBs
NCBI-GeneID: 939806
NCBI-ProteinID: NP_389017
Pasteur: BG13129
BSORF: BG13129
UniProt: O31596 A0A6M4JF08
Position
1210500..1211285
AA seq 261 aa
MSVEQTYSWLRKAGSIDDLAHYIIPLFSGAEKKNWKGILGHLQHHGMFKNIKEGIQTVSK
LKEKGFYGHIQKEEQYLKNKWQGPDVPIVTLPVDERNRRIRLEFGSKSGLAFQDKMFLFL
SSDLDFGSVSALMTHEYHHVCRLGHLTKEEKDVTLLDTIIMEGLAEYAVYERFGRSQTAE
WTTWYTPEQLQALYEKKIAPHRDIKRDNRLFPQLLFGKGYQPKMLGYAVGFNIVKKYLTA
SKASTADGLSIPAETFLDAML
NT seq 786 nt   +upstreamnt  +downstreamnt
atgagtgtagaacaaacatatagctggctcaggaaggccggttcaatagatgatttggcg
cattacattatcccgcttttttcaggtgcggagaaaaagaactggaagggcattctgggg
catcttcagcatcatgggatgtttaaaaacataaaagagggtattcagacggtttccaag
ctgaaggaaaaaggtttttacggacatatccaaaaggaagaacagtacctcaaaaacaaa
tggcaaggtcctgatgtaccaattgttacgctgccggttgatgaacgaaacaggagaatc
cgtttagaattcggatcaaaatcaggactcgcctttcaagacaaaatgttcctttttctt
tcgtcagatttagattttgggtcggtatctgcccttatgacgcatgagtatcatcacgtt
tgccggttaggtcatctgacaaaagaggaaaaggatgtcacattacttgatacaatcatc
atggaagggctggcggaatatgctgtttatgagaggttcggccgaagtcaaacggctgaa
tggacgacttggtatacaccggaacagcttcaggctttatatgaaaaaaagattgcgccc
catcgggatatcaaacgggataatcgattatttccccagctgttattcggcaaaggatat
cagccaaaaatgcttggatacgcagttggattcaatattgtaaaaaaatatttaaccgcc
agcaaggcaagcaccgcagacgggctgtccattcctgctgagacctttttggatgcaatg
ctttaa

DBGET integrated database retrieval system