KEGG   Bacillus subtilis subsp. subtilis 168: BSU11360
Entry
BSU11360          CDS       T00010                                 

Gene name
appD
Definition
(RefSeq) oligopeptide transport ATP-binding protein AppD
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU11360 (appD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU11360 (appD)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    BSU11360 (appD)
SSDB
Motif
Pfam: ABC_tran oligo_HPY SMC_N AAA_21 AAA_29 AAA_25 TniB ATPase
Other DBs
NCBI-GeneID: 936391
NCBI-ProteinID: NP_389018
Pasteur: BG11085
BSORF: BG11085
UniProt: P42064 A0A6M4JGZ5
Position
1211477..1212463
AA seq 328 aa
MSTLLEVNNLKTYFFRKKEPIPAVDGVDFHISKGETVALVGESGSGKSITSLSIMGLVQS
SGGKIMDGSIKLEDKDLTSFTENDYCKIRGNEVSMIFQEPMTSLNPVLTIGEQITEVLIY
HKNMKKKEARQRAVELLQMVGFSRAEQIMKEYPHRLSGGMRQRVMIAIALSCNPKLLIAD
EPTTALDVTIQAQVLELMKDLCQKFNTSILLITHDLGVVSEAADRVIVMYCGQVVENATV
DDLFLEPLHPYTEGLLTSIPVIDGEIDKLNAIKGSVPTPDNLPPGCRFAPRCPKAMDKCW
TNQPSLLTHKSGRTVRCFLYEEEGAEQS
NT seq 987 nt   +upstreamnt  +downstreamnt
atgagcacacttttagaagtgaataatttaaagacttattttttcaggaaaaaggagccg
atccctgcggttgacggagtcgattttcacatcagcaaaggcgaaaccgtcgcgcttgta
ggtgaatcgggctccggaaaaagcattacttctttatcaattatgggcctcgtccaaagc
tcaggcggaaaaatcatggacggctctattaaactcgaagacaaagacctcacctcattc
actgaaaacgattattgcaaaatccgcggtaacgaagtatccatgatctttcaggaacca
atgacctcccttaatccggtgttaacaatcggagaacaaattaccgaagtgctgatttac
cataaaaacatgaagaaaaaagaagcccgtcaacgagctgttgaactcttgcagatggtc
ggtttctcccgggcggagcaaattatgaaggagtacccgcatcggctgtccggcggtatg
agacagagggtgatgattgccatcgcactgagctgtaatcctaaactgctcattgctgat
gaaccaacgacagcgctggacgtgacaatacaagcccaggtgctggagctcatgaaagat
ctctgtcagaagttcaatacatcgattcttctcatcacacacgacttaggtgtcgtgtct
gaagctgccgatagagtgattgtcatgtactgcggacaagtcgtagaaaacgccactgtt
gatgacttatttttagaaccgcttcatccgtatacagaaggcctgcttacgtcaattcct
gttatagatggagagattgataaattaaatgcgattaaaggcagtgtgcctacaccggat
aatctgccgccggggtgccgttttgccccaaggtgcccgaaagctatggataagtgctgg
acaaatcagccttcgcttttgacacacaaaagcggaagaacggtgagatgctttttatat
gaggaagagggtgccgaacaatcatga

DBGET integrated database retrieval system