KEGG   Bacillus subtilis subsp. subtilis 168: BSU11370
Entry
BSU11370          CDS       T00010                                 

Gene name
appF
Definition
(RefSeq) oligopeptide transport ATP-binding protein AppF
  KO
K02032  peptide/nickel transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU11370 (appF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU11370 (appF)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    BSU11370 (appF)
SSDB
Motif
Pfam: ABC_tran oligo_HPY SMC_N G-alpha ATP-synt_ab AAA_22 AAA_13 AAA_29 AAA_21 Rad17
Other DBs
NCBI-GeneID: 936390
NCBI-ProteinID: NP_389019
Pasteur: BG11086
BSORF: BG11086
UniProt: P42065 A0A6M4JHD5
Position
1212460..1213449
AA seq 329 aa
MTAANQETILELRDVKKYFPIRSGLFQRKVGDVKAVDGVSFSLKKGETLGIVGESGCGKS
TAGRTMIRLYKPTEGQILFKGQDISNLSEEKLRKSVRKNIQMVFQDPFASLNPRKTLRSI
IKEPFNTHNMYTMRERNEKVEELLARVGLHPSFAGRYPHEFSGGQRQRIGIARALTLNPE
LIIADEPVSALDVSIQAQVINLMEELQEEFNLTYLFISHDLSVVRHISDRVGVMYLGKMM
ELTGKHELYDNPLHPYTQALLSSVPVTRKRGSVKRERIVLKGELPSPANPPKGCVFHTRC
PVAKPICKEQIPEFKEAAPSHFVACHLYS
NT seq 990 nt   +upstreamnt  +downstreamnt
atgacagcagctaatcaagaaacaatcttagagcttcgtgacgtaaaaaaatactttccg
atccggtcaggcctttttcaaagaaaagtcggtgatgtaaaagcggtggatggtgtttca
ttttcgttaaaaaaaggagaaacactcggaatcgttggagagtcgggctgcggaaaatcg
actgccggcagaacgatgatcagactgtacaaaccgacagagggccaaattctttttaaa
gggcaggatatttccaatctgtcagaggagaagctgcggaagagtgtccgcaaaaatatt
caaatggttttccaagatccatttgcttcgttaaacccgagaaagaccctgcgttccatc
ataaaggagccgtttaatacgcacaacatgtataccatgcgtgaacgaaacgaaaaagtt
gaagagctgcttgcaagagtagggcttcacccgtcgtttgccggccgttatccccatgag
ttttcaggcggccagcgtcagcggatcggcattgccagagcactcactttgaatccagag
ctgatcattgcagatgagccggtttccgcacttgatgtatccattcaggcccaagtgatt
aacttgatggaggaattacaggaagaatttaatcttacgtatctatttatctctcatgat
ctgagtgtcgtccgccatatcagcgacagagtcggagtaatgtatcttggcaaaatgatg
gaactgaccggcaagcatgagctttatgacaacccgcttcacccatatacccaagcgctt
ttatcctccgttccggttacaagaaaaagaggttctgtcaaacgtgaacgcattgtcctg
aagggagaactgcctagtccggccaacccgccaaaaggctgcgtattccacacaagatgt
cctgttgcaaaaccgatatgcaaggaacaaataccagaatttaaagaagctgctcccagc
cactttgtggcttgtcacctttatagctaa

DBGET integrated database retrieval system